KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593453
Entry
100593453         CDS       T03265                                 

Gene name
CTNNA1
Definition
(RefSeq) catenin alpha-1 isoform X1
  KO
K05691  catenin alpha
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04390  Hippo signaling pathway
nle04520  Adherens junction
nle04670  Leukocyte transendothelial migration
nle05100  Bacterial invasion of epithelial cells
nle05200  Pathways in cancer
nle05213  Endometrial cancer
nle05226  Gastric cancer
nle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100593453 (CTNNA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100593453 (CTNNA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100593453 (CTNNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593453 (CTNNA1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100593453 (CTNNA1)
   05213 Endometrial cancer
    100593453 (CTNNA1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100593453 (CTNNA1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100593453 (CTNNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nle04812]
    100593453 (CTNNA1)
Cytoskeleton proteins [BR:nle04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100593453 (CTNNA1)
SSDB
Motif
Pfam: Vinculin Peptidase_C5
Other DBs
NCBI-GeneID: 100593453
NCBI-ProteinID: XP_030684402
Ensembl: ENSNLEG00000009068
LinkDB
Position
2
AA seq 906 aa
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKTAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgactgctgtccacgcaggcaacataaacttcaagtgggatcccaaaagtctagagatc
aggactctggcagttgagagactgttggagcctcttgttacacaggttacaaccctggta
aacaccaatagtaaggggccctctaataagaagagaggtcgttctaagaaggcccatgtt
ttggctgcatctgttgaacaagcaactgagaatttcttggagaagggggataaaattgcg
aaggagagccagtttctcaaggaggagcttgtggctgctgtagaagatgttcgaaaacaa
ggtgatttgatgaagactgccgcgggagagttcgcagatgatccctgctcttctgtgaag
cgaggcaacatggttcgggcagctcgagctttgctctctgctgttacccggttgctgatt
ttggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtggaagatggt
atcttgaagttgaggaatgctggcaatgaacaagacttaggaatccagtataaagcccta
aaacctgaagtggataagctgaacattatggcagccaaaagacaacaggaattgaaagat
gttggccatcgtgatcagatggctgcagctagaggaatcctgcagaagaacgttccgatc
ctctatactgcatcccaggcatgcctacagcaccctgatgtcgcagcctataaggccaac
agggacctgatatacaagcagctgcagcaggcggtcacaggcatttccaatgcagcccag
gccactgcctcagatgatgcctcccagcaccagggtggaggaggaggagaactggcatat
gcactcaataactttgacaaacaaatcattgtggaccctttgagcttcagcgaggagcgc
tttaggccttccctggaggagcgcctggaaagcatcattagtggggctgccttgatggcc
gactcgtcctgcacgcgtgatgaccgtcgtgagcgaattgtggcagagtgtaatgctgtc
cgccaggccctgcaggatctgctttcggagtatatgggcaatgctggacgtaaagaaaga
agtgatgcactcaattctgcaatagataaaatgaccaagaagaccagggacttgcgtaga
cagctccgcaaagctgtcatggaccacgtttcagattctttcctggaaaccaatgttcca
cttttggtattgattgaagctgcaaagaatggaaatgagaaagaagttaaggagtatgcc
caagttttccgtgaacatgccaacaaactgattgaggttgccaacttggcctgttccatc
tcaaataatgaagaaggtgtaaagcttgttcgaatgtctgcaagccagttagaagccctc
tgtcctcaggttattaatgctgcattggctttagcagcaaaaccacagagtaaactggcc
caagagaacatggatctttttaaagaacaatgggaaaaacaagtccgtgttcttacagat
gctgtcgatgacattacttccattgatgacttcttggctgtctcagagaatcacattttg
gaagatgtgaacaaatgtgtcattgctctccaagagaaggatgtggatggcctggaccgc
acagctggtgcaattcgaggccgggcagcccgggtcattcacgtagtcacctcagagatg
gacaactatgagccaggagtctacacagagaaggttctggaagccactaagctgctctcc
aacacagtcatgccacgttttactgagcaagtagaagcagccgtggaagccctcagctcg
gaccctgcccagcccatggatgagaatgagtttatcgatgcctcccgcctggtatatgat
ggcatccgggacatcaggaaagcagtgctgatgataaggacccctgaggagttggatgac
tctgactttgagacagaagatttcgatgtcagaagcaggacgagcgtccagacagaagac
gatcagctgatagctggccagagtgcccgggcgatcatggctcagcttccccaggagcaa
aaagcaaagattgcagaacaggtggccagcttccaggaagaaaagagcaagctggatgct
gaagtgtccaaatgggacgacagtggcaatgacatcattgtgctggccaagcagatgtgc
atgattatgatggagatgactgactttacccgaggtaaaggaccactcaaaaatacatca
gatgtcatcagtgctgccaagaaaattgctgaggcgggatccaggatggacaagcttggc
cgtactatcgcagaccactgccctgactcggcttgcaagcaggacctgctggcctacctg
caacgcatcgccctctactgccaccagctcaacatctgcagcaaggtcaaggctgaggtg
cagaatctcggcggggagctcgttgtctctggggtggacagcgccatgtccctgatccag
gcagccaagaacctgatgaatgctgtggtgcagacagtgaaggcatcctacgtcgcctct
accaaataccaaaagtcacagggtatggcttccctcaatcttcctgctgtgtcttggaag
atgaaggcaccagagaaaaagcccttggtgaagagagagaaacaggatgagacacagacc
aagattaaacgggcatctcagaagaagcacgtgaacccggtgcaggccctcagcgagttc
aaagctatggacagcatctaa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100599144
Entry
100599144         CDS       T03265                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha-2 isoform X5
  KO
K05691  catenin alpha
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04390  Hippo signaling pathway
nle04520  Adherens junction
nle04670  Leukocyte transendothelial migration
nle05100  Bacterial invasion of epithelial cells
nle05200  Pathways in cancer
nle05213  Endometrial cancer
nle05226  Gastric cancer
nle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100599144 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100599144 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100599144 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100599144 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100599144 (CTNNA2)
   05213 Endometrial cancer
    100599144 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100599144 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100599144 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nle04812]
    100599144 (CTNNA2)
Cytoskeleton proteins [BR:nle04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100599144 (CTNNA2)
SSDB
Motif
Pfam: Vinculin DUF1266
Other DBs
NCBI-GeneID: 100599144
NCBI-ProteinID: XP_012358124
Ensembl: ENSNLEG00000001259
LinkDB
Position
14
AA seq 584 aa
MDGWRRPLKSVGKVCEKKMKTSEMHTVSEAQTGRKEKGDPLNIAIDKMTKKTRDLRRQLR
KAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQVFREHANKLVEVANLACSISNN
EEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVD
DITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENY
EAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVYDGVR
DIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKA
KIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDV
INAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQN
LGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMK
APEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggatggatggagaaggccactcaagtcagtaggcaaagtctgtgaaaaaaaaatgaag
acttctgagatgcataccgtgtctgaagcacagactggaaggaaagaaaaaggagatcct
ctcaacattgcgattgataagatgactaagaaaacaagagatctaaggagacagcttcgg
aaagcagtgatggatcacatatctgattctttcttggaaaccaatgttcctttgctagtt
ctcattgaggctgcaaagagcggaaatgaaaaggaagtgaaagaatatgcccaagttttc
cgtgagcatgccaacaaactggtagaggttgccaatttggcctgttccatctccaacaat
gaagaaggggtgaaattagttcggatggcagccacccagattgacagcttgtgtccccag
gtcatcaatgccgctctgacactggctgcccggccacagagcaaagttgctcaggataac
atggacgtcttcaaagaccagtgggagaagcaggtccgagtgttgacagaggccgtggat
gacatcacctcagtggatgacttcctctctgtctcagaaaatcacatcttggaggatgtg
aacaagtgtgtgatagccctccaagagggtgatgtggacactctggacaggactgcaggg
gccatcaggggccgggcagctcgagtcatacacatcatcaatgctgagatggagaactat
gaagctggggtttatactgagaaggtgctggaagctacaaaattgctttctgaaacagtg
atgccacgctttgcagaacaagtagaggttgccattgaagccctgagtgccaacgttcct
caaccatttgaggagaatgagttcatcgatgcctctcgcctggtgtatgacggcgttcgg
gacatcagaaaggctgtgctgatgatcaggaccccagaagaactagaggatgattccgac
tttgagcaggaagattatgatgtgcgtagcaggacaagtgttcagactgaggatgaccag
ctcattgcagggcagagcgcacgggccatcatggcgcaactaccgcaggaggagaaggca
aaaatagctgagcaggtggagatattccatcaagagaaaagcaagctggatgcagaagtg
gccaaatgggacgacagcggcaatgatatcattgtactggccaagcagatgtgtatgatc
atgatggaaatgacagacttcacaagaggcaaaggcccattgaaaaatacatctgatgtc
attaatgctgccaagaaaattgccgaagcaggttctcgaatggacaaattagctcgcgct
gtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaacga
attgccttgtattgccatcagcttaatatctgcagcaaggtgaaggcagaagtgcagaat
ctgggaggagagctcattgtgtcagggctggacagtgccacatcgcttatccaggcagct
aaaaacctgatgaatgctgttgtcctcacggtgaaagcatcctatgtggcctcaaccaaa
taccagaaggtctatggaacagcagctgtcaactcacctgttgtgtcttggaagatgaag
gctccagagaagaagccccttgtgaagagagaaaagcctgaagaattccagacacgagtt
cgacgaggttctcagaagaaacacatttcgcctgtacaggctttaagtgaattcaaagca
atggattccttctag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100606736
Entry
100606736         CDS       T03265                                 

Gene name
CTNNA3
Definition
(RefSeq) catenin alpha-3 isoform X1
  KO
K05691  catenin alpha
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04390  Hippo signaling pathway
nle04520  Adherens junction
nle04670  Leukocyte transendothelial migration
nle05100  Bacterial invasion of epithelial cells
nle05200  Pathways in cancer
nle05213  Endometrial cancer
nle05226  Gastric cancer
nle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100606736 (CTNNA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100606736 (CTNNA3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100606736 (CTNNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100606736 (CTNNA3)
  09162 Cancer: specific types
   05226 Gastric cancer
    100606736 (CTNNA3)
   05213 Endometrial cancer
    100606736 (CTNNA3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100606736 (CTNNA3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100606736 (CTNNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nle04812]
    100606736 (CTNNA3)
Cytoskeleton proteins [BR:nle04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100606736 (CTNNA3)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 100606736
NCBI-ProteinID: XP_003258266
Ensembl: ENSNLEG00000012042
UniProt: G1RN12
LinkDB
Position
18
AA seq 895 aa
MSADTPITLNIDPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSSRKKGRSKRASVLLA
SVEEATWNLLDKGEKIAQEATVLKDELTASLEEVRKESEALKVSAERFTDDPCFLPKREA
VVQAARALLAAVTRLLILADMIDVMCLLQHVSAFQRTFESLKNVANKSDLQKTYQKLGKE
LENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICSACLEHSDVASLKASKDT
VCEEIQNALNVISNASQGIQNMTTPPEPQAATLGSALDELENLIVLNPLTVTEEEIRPSL
EKRLEAIISGAALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNAGKKERSNTLN
IALDNMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLTEAAKNGREKEIKEYAAIFHE
HTSRLVEVANLACSMSTNEDGIKIVKIAANHLETLCPQIINAALALAARPKSQVVRNTME
MYKRTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAI
RGRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALEALSKNSLNV
LDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRSHTSIQTEGKTDRA
KMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKNMCMIMMEMTDFTR
GKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLK
ICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAG
PRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKRIHPLQVMSEFRGRQIY
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgtcagctgataccccaatcacattgaatatcgatcctcaggatctgcaggtccaaaca
ttcaccgtagagaagctactggagcctctcataatccaggttaccacacttgtaaactgt
ccccagaacccttccagcaggaaaaaaggacgttcaaaaagagccagtgtccttctagct
tctgtggaggaagcaacttggaatttattagacaagggagagaagattgcccaggaagct
acagttttaaaggatgagcttacggcttcacttgaggaagttcgcaaagaaagtgaagct
ctgaaagtatcagctgagagatttacagatgacccctgttttctcccaaaaagggaggca
gtggttcaagctgcccgtgccttgctggctgcagtgacaagactccttatccttgcggac
atgattgatgtcatgtgcctcttgcaacatgtgtcagcttttcaaaggacatttgagtct
ctcaaaaatgttgccaacaaatctgacctccagaaaacctaccagaagcttgggaaggag
ctggaaaatttggattatttagccttcaaacgtcagcaggacttaaaatctccaaatcag
agggatgaaattgcaggagcccgagcctcactgaaggagaactctcccctcttgcattca
atttgttcagcttgtttggagcattctgatgttgcttccctcaaagcaagcaaggacaca
gtttgtgaagaaattcagaatgctctcaatgtaatttcaaatgcttcgcaagggatccag
aatatgacaaccccaccagaacctcaggcagcaaccctgggaagtgcccttgatgagctg
gagaatttaattgtcctgaatccactcacagtgactgaggaggaaataagaccatcacta
gagaaacgccttgaagccattatcagtggggctgctctgctggcggattcttcatgcacg
agggacttccaccgagagcggattatcgcagaatgcaacgccattcgccaggctcttcag
gatctgctttcagagtacatgaacaatgctggaaaaaaagaaaggagtaataccctgaat
attgctttagacaacatgtgtaagaagacaagagaccttcgcagacagctccgcaaggct
attatagatcatgtgtcagactctttcttggatacgacagtccctcttttggttctcact
gaagctgctaagaatggccgggaaaaggaaataaaagaatatgctgcgatatttcatgaa
cacaccagcaggcttgtagaggtggcaaatcttgcttgttccatgtcaacaaatgaagat
ggaattaaaattgtcaaaattgcagccaatcatttggaaaccttgtgtccacagattatt
aatgcggcacttgctttggctgcaagacccaaaagtcaggtggtcagaaacaccatggaa
atgtacaagcgtacgtgggagaatcatatacatgtcctcactgaagctgtagatgacatt
acaagcattgatgacttccttgctgtatctgaaagccatatcttggaagatgtcaacaag
tgtatcatagccttaagagaccaggatgctgataatttagaccgtgctgcgggtgctatc
agaggccgggcagcaagagttgctcacatcgtcacgggtgaaatggacagttacgagcca
ggggcttacacggaaggtgtaatgagaaatgttaacttccttacgagtactgtaattcct
gaatttgtaacacaagtgaatgttgccctggaagccttaagcaaaaactcattgaatgtg
ttggatgataatcaatttgtggacatctcaaagaagatctatgatacaattcatgatatc
agatgttcagtcatgatgattcggaccccagaggaactggaggatgtttctgacctcgaa
gaggaacacgaggtccgcagtcacaccagcattcagaccgaagggaaaactgatagggct
aagatgactcaactgcctgaggcagaaaaagaaaagattgctgagcaagttgctgatttc
aagaaagtaaagagtaagctggatgctgagattgagatatgggatgatacaagcaacgac
atcattgttctggccaagaacatgtgtatgatcatgatggagatgacagacttcaccagg
ggcaaaggaccactaaagcatacaactgatgtgatctatgcagcgaaaatgatatcagaa
tcaggatcaaggatggatgtccttgctcggcagattgctaatcagtgcccagatccatct
tgcaaacaggacttgttggcctacctggaacagattaagttctactcccaccaactgaaa
atctgcagtcaagttaaagctgagatccagaacctgggaggagagctcatcatgtcagct
ttggacagtgtcacctccctgatccaagcagccaaaaatttaatgaatgctgtagtgcaa
acagtgaaaatgtcttacattgcctcaaccaagatcatccgaatccagagtcctgctggg
ccccggcacccagttgtgatgtggagaatgaaggctcctgcaaaaaaacccttgattaaa
agagagaagccagaggaaacgtgtgcagctgtcagacgaggctcagcaaagaaaagaatc
catccattgcaagtcatgagtgaatttagaggaagacaaatctactga

DBGET integrated database retrieval system