KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593773
Entry
100593773         CDS       T03265                                 

Gene name
KRAS
Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04062  Chemokine signaling pathway
nle04068  FoxO signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04137  Mitophagy - animal
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04371  Apelin signaling pathway
nle04540  Gap junction
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04625  C-type lectin receptor signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04714  Thermogenesis
nle04720  Long-term potentiation
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04730  Long-term depression
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04912  GnRH signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04916  Melanogenesis
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05034  Alcoholism
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05218  Melanoma
nle05219  Bladder cancer
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100593773 (KRAS)
   04012 ErbB signaling pathway
    100593773 (KRAS)
   04014 Ras signaling pathway
    100593773 (KRAS)
   04015 Rap1 signaling pathway
    100593773 (KRAS)
   04370 VEGF signaling pathway
    100593773 (KRAS)
   04371 Apelin signaling pathway
    100593773 (KRAS)
   04068 FoxO signaling pathway
    100593773 (KRAS)
   04072 Phospholipase D signaling pathway
    100593773 (KRAS)
   04071 Sphingolipid signaling pathway
    100593773 (KRAS)
   04151 PI3K-Akt signaling pathway
    100593773 (KRAS)
   04150 mTOR signaling pathway
    100593773 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100593773 (KRAS)
   04137 Mitophagy - animal
    100593773 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    100593773 (KRAS)
   04218 Cellular senescence
    100593773 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100593773 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    100593773 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100593773 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100593773 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    100593773 (KRAS)
   04660 T cell receptor signaling pathway
    100593773 (KRAS)
   04662 B cell receptor signaling pathway
    100593773 (KRAS)
   04664 Fc epsilon RI signaling pathway
    100593773 (KRAS)
   04062 Chemokine signaling pathway
    100593773 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100593773 (KRAS)
   04929 GnRH secretion
    100593773 (KRAS)
   04912 GnRH signaling pathway
    100593773 (KRAS)
   04915 Estrogen signaling pathway
    100593773 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    100593773 (KRAS)
   04917 Prolactin signaling pathway
    100593773 (KRAS)
   04921 Oxytocin signaling pathway
    100593773 (KRAS)
   04926 Relaxin signaling pathway
    100593773 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    100593773 (KRAS)
   04919 Thyroid hormone signaling pathway
    100593773 (KRAS)
   04916 Melanogenesis
    100593773 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100593773 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    100593773 (KRAS)
   04726 Serotonergic synapse
    100593773 (KRAS)
   04720 Long-term potentiation
    100593773 (KRAS)
   04730 Long-term depression
    100593773 (KRAS)
   04722 Neurotrophin signaling pathway
    100593773 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100593773 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    100593773 (KRAS)
   04213 Longevity regulating pathway - multiple species
    100593773 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    100593773 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593773 (KRAS)
   05206 MicroRNAs in cancer
    100593773 (KRAS)
   05205 Proteoglycans in cancer
    100593773 (KRAS)
   05203 Viral carcinogenesis
    100593773 (KRAS)
   05230 Central carbon metabolism in cancer
    100593773 (KRAS)
   05231 Choline metabolism in cancer
    100593773 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100593773 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100593773 (KRAS)
   05212 Pancreatic cancer
    100593773 (KRAS)
   05225 Hepatocellular carcinoma
    100593773 (KRAS)
   05226 Gastric cancer
    100593773 (KRAS)
   05214 Glioma
    100593773 (KRAS)
   05216 Thyroid cancer
    100593773 (KRAS)
   05221 Acute myeloid leukemia
    100593773 (KRAS)
   05220 Chronic myeloid leukemia
    100593773 (KRAS)
   05218 Melanoma
    100593773 (KRAS)
   05211 Renal cell carcinoma
    100593773 (KRAS)
   05219 Bladder cancer
    100593773 (KRAS)
   05215 Prostate cancer
    100593773 (KRAS)
   05213 Endometrial cancer
    100593773 (KRAS)
   05224 Breast cancer
    100593773 (KRAS)
   05223 Non-small cell lung cancer
    100593773 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100593773 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100593773 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    100593773 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100593773 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100593773 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    100593773 (KRAS)
   05161 Hepatitis B
    100593773 (KRAS)
   05160 Hepatitis C
    100593773 (KRAS)
   05163 Human cytomegalovirus infection
    100593773 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100593773 (KRAS)
   05165 Human papillomavirus infection
    100593773 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100593773 (KRAS)
   01522 Endocrine resistance
    100593773 (KRAS)
Membrane trafficking [BR:nle04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100593773 (KRAS)
GTP-binding proteins [BR:nle04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100593773 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin AAA_25 CbiA
Other DBs
NCBI-GeneID: 100593773
NCBI-ProteinID: XP_030660363
Ensembl: ENSNLEG00000027684
LinkDB
Position
23
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaggactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgtaa

DBGET integrated database retrieval system