KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100594023Help
Entry
100594023         CDS       T03265                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00020  Citrate cycle (TCA cycle)
nle00190  Oxidative phosphorylation
nle01100  Metabolic pathways
nle01200  Carbon metabolism
nle04714  Thermogenesis
nle04932  Non-alcoholic fatty liver disease (NAFLD)
nle05010  Alzheimer disease
nle05012  Parkinson disease
nle05016  Huntington disease
Module
nle_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nle_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100594023
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100594023
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100594023
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100594023
   05012 Parkinson disease
    100594023
   05016 Huntington disease
    100594023
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100594023
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100594023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 100594023
NCBI-ProteinID: XP_004092820
LinkDB All DBs
Position
13
AA seq 122 aa AA seqDB search
GCGPEEDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMDGIPT
SYKGQVLRHVNGQDQIVPGLYTRGEAACASVHGANRLGANSLLDLVVWSGMCPEHRKVMQ
AW
NT seq 370 nt NT seq  +upstreamnt  +downstreamnt
aggctgtggccctgaggaagatcacgtctacctgcagctgcaccatctacctccagagca
gctggccacgcgcctgcccggcatttcagagacagccatgatcttcgctggcgtggacgt
cacgaaggagccaatccctgtcctccccaccgtgcattataacatggatggcattcccac
cagctacaaggggcaggtcctgaggcatgtgaatggccaggatcagattgtgcccggcct
gtacacccgtggggaggccgcctgtgcctcggtacatggtgccaaccgcctcggggcaaa
ctcgctgttggacctggtcgtctggtcaggcatgtgccctgagcatcgaaaagtcatgca
ggcctggtaa

DBGET integrated database retrieval system