KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100594235Help
Entry
100594235         CDS       T03265                                 

Gene name
AMY2B
Definition
(RefSeq) alpha-amylase 2B
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00500  Starch and sucrose metabolism
nle01100  Metabolic pathways
nle04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100594235 (AMY2B)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100594235 (AMY2B)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100594235 (AMY2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100594235
NCBI-ProteinID: XP_003282012
UniProt: G1S045
LinkDB All DBs
Position
12
AA seq 511 aa AA seqDB search
MKFFLLLLTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQISPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVHIYVDAVINHMCGN
GVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGL
LDLALEKDYVRSEIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDGLHNLNSSWFPEG
SKPFIYQEIIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGGSILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RQFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKIDGNCTGI
KIYVSDDGKAHFSVSNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttttgttgcttttaaccattgggttctgctgggctcagtattccccaaat
acgcaacaaggacggacatctattgttcatctgtttgaatggcggtgggttgatattgct
cttgaatgtgagcgatatttagcacccaagggatttggaggggttcagatctctccacca
aatgaaaatgttgcaattcacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgcaacaatgttggggttcatatttatgtggatgctgtaattaatcatatgtgtggtaat
ggtgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggattttaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactacaatgatgctactcaggtcagagattgtcgtctggttggtctt
cttgatcttgcactggagaaagattatgtgcgttccgagattgccgaatatatgaaccat
ctcattgacattggtgttgcagggttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacggactgcataatctaaacagtagctggttccctgaagga
agtaaacctttcatttaccaggagataattgatctgggtggtgagccaattaaaagcagt
gactactttggaaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcatgccttctgacagagcacttgtctttgtggataaccatgacaatcaacgaggacat
ggggctggaggaggctctattcttaccttctgggatgccaggctgtataaaatggcagtt
ggatttatgcttgctcatccatatggatttacacgagtaatgtcaagctaccgttggcca
agacagtttgaaaatggaaaagatgttaatgattgggttgggccaccaaatgataatgga
gtaactaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttgctttccgcaatgtagtggatggccagcct
tttacaaactggtatgataatgggagcaaccaagtggcttttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggtcattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattgatggcaattgcacaggcatt
aaaatctacgtttctgatgatggcaaagctcatttttctgttagtaactctgctgaagat
ccatttattgcaatccatgctgaatctaaattataa

DBGET integrated database retrieval system