KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100594252Help
Entry
100594252         CDS       T03265                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00052  Galactose metabolism
nle00500  Starch and sucrose metabolism
nle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100594252 (GANC)
   00500 Starch and sucrose metabolism
    100594252 (GANC)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100594252 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100594252
NCBI-ProteinID: XP_012362699
UniProt: M3ZCN0
LinkDB All DBs
Position
6
AA seq 914 aa AA seqDB search
MEASEKEEISVEDEAIDKNIFRDCNKIAFYRRQKQWLSKKSTYQALLESVTTDEDSTRFQ
IINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGDLKCHITANPFKVDLVSEEEVVLSINSLGQLYFEHLQILHKQRAAKENEEEA
SVDTSQKNQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRFPNPKK
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFIWNDMNEPSVFRGPEQTMQKNAVHHGNWEHREL
HNIYGFYHQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSNLKISIP
MLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPDELKTFHMEDEYMLGNA
LLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVVP
IKPTVGKSTGWMTESSYGLQVALSTKGSSVGELYLDDGHSFQYLHQKQFLHRKFSFCSSV
LINSSADQRGHYPSKCVVEQILVLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSTLSLEK
LSLNIATDWEVRII
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagcatctgagaaagaggaaataagtgttgaagatgaagctatagataaaaacatt
ttcagagactgtaacaagatcgcattttacaggcgtcagaaacagtggctttccaagaag
tccacctatcaggcattactggagtcagtcacaacagatgaagacagcaccaggttccaa
atcatcaatgaagcgagtaaggttcctctcctggctgaaatttatggtatagaaggaaac
attttcaggcttaaaattaatgaagagactcctctaaaacccaggtttgaagttcctgat
gtcctcacaagcaagccaagcactgtaaggctgatttcatgctcaggggacacaggcagt
ctgatattggcagatggaaaaggagacctgaagtgccatatcacagcaaacccattcaag
gtagacttggtgtctgaagaagaggttgtgcttagcataaattctctgggccaattatac
tttgagcatctacagattcttcacaaacaaagagctgctaaagaaaatgaggaggaggca
tcagtggacacctctcagaaaaatcaagaagatctgggcctgtgggaagagaaatttgga
aagtttgtggatatcaaagctaatggcccttcttctattggtttggatttctccttgcac
ggatttgagcatctttatgggatcccacaacatgcggaatcacaccaacttaaaaatact
ggtgatggagatgcttaccgtctttataacctggatgtctatggataccaaatatatgat
aaaatgggcatttatggttcagtaccttatctcctggcccacaaactgggcagaactata
ggtattttctggctgaatgcctcagaaacactggtggagatcaatacagagcctgcagta
gagtacacactgacccagatgggcccagttgctgctaaacaaaaggtcagatctcgcact
catgtgcactggatgtcagagagtggcatcattgatgtttttctgctgacaggacctaca
ccttctgatgtcttcaaacagtactcataccttacaggcacacaagccatgccccctctt
ttctctttgggataccaccagtgccgctggaactatgaagatgagcaggatgtaaaagca
gtggatgcagggtttgatgagcatgacattccttatgatgccatgtggctggacatagag
cacactgagggcaagaggtacttcacctgggacaaaaacagattcccaaaccccaagaag
atgcaagagctgctcaggagcaaaaagcgtaagcttgtggtcatcagtgacccccacatc
aagattgatcctgactactcagtgtatgtgaaggccaaagatcagggcttctttgtgaag
aatcaggaaggggaagactttgaaggggtgtgctggccaggtctctcctcttatctggat
ttcaccaatcccaaagtcagagagtggtattcaagtctttttgctttccctgtttatcag
ggatctacggacatcctcttcatttggaatgacatgaatgaaccctctgtctttagaggg
ccagagcaaaccatgcagaagaatgccgttcatcatggcaattgggagcacagagaactc
cacaacatctacggtttttatcaccaaatggctactgcagaaggactgatacaacgatct
aaagggaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaagtat
ggtgccgtgtggacaggcgacaacacagcagaatggagcaacttgaaaatttctatccca
atgttactcactctcagcattactgggatctctttttgtggagctgacataggcgggttc
attgggaatccagagacagagctgctagtgcgttggtaccaggccggagcctaccagccc
ttcttccgtggacatgccaccatgaacaccaagcgacgggagccctggctctttggggag
gaacacacccggctcatccgagaagccatcagagagcgctatggcctcctgccttactgg
tattctctgttctaccatgcacatgtggcttcccaacctgtcatgaggcctctgtgggta
gagttccctgatgaactaaagacttttcatatggaagatgaatacatgttggggaatgca
ttattggttcatccagtcacagaaccaaaagccaccacagttgatgtgtttcttccagga
tcaaacgaggtctggtatgactataagacatttgctcattgggaaggagggtgtactgta
aagatcccagtagccttggacactattccagtgtttcagcgaggtggaagtgtggtacca
ataaagccaactgtaggaaaatccacaggctggatgactgaatcctcctatggactccag
gttgctctaagcactaagggttcttcagtgggtgagttatatcttgatgatggccattca
ttccaatacctccaccagaagcaatttttgcacaggaagttttcattctgttccagtgtt
ctgatcaatagttctgctgaccagaggggtcattatcccagcaagtgtgtggtggagcag
atcttggtcttaggcttcaggaaggagccatcttctgtgactacccactcatctgatggt
aaagatcagcctgtggcttttacgtattgtgccaaaacatccaccctgagcctggagaag
ctctcgctcaacattgccactgactgggaggtccgcatcatatga

DBGET integrated database retrieval system