KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100594332Help
Entry
100594332         CDS       T03265                                 

Gene name
SLC25A26
Definition
(RefSeq) solute carrier family 25 member 26
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nle02000]
    100594332 (SLC25A26)
Transporters [BR:nle02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100594332 (SLC25A26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 100594332
NCBI-ProteinID: XP_003279640
UniProt: G1R7J1
LinkDB All DBs
Position
21
AA seq 186 aa AA seqDB search
MKHMLAASAGEMVACLIRVPSEVVKQRAQVSASTRTFQIFSNILYEEGVQGLYRGYKSTV
LREIPFSLVQFPLWESLKALWSWRQDHVVDSWQSAVCGAFAGGFAAAVTTPLDVAKTRIM
LAKAGSSTANGNVLSALHGVWRSQGLAGLFAGVFPRMAAISLGGFIFLGAYDRTHSLLLE
VGRKSP
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatatgttggctgcctctgctggagaaatggttgcctgcctgattcgagttcca
tctgaagtggttaagcagagggcacaggtatctgcttctactagaacatttcagattttc
tctaacatcttatatgaagagggtgtccaagggttgtatcgaggctataaaagcacagtt
ttaagagagattcctttttctttggtccagtttcccttatgggagtccttaaaagccctc
tggtcctggaggcaggatcatgtggtggattcttggcagtcagcagtctgtggagctttt
gcaggtggatttgccgctgcagtcaccacccctctagatgtggcaaagacgagaattatg
ctggcaaaggctggctccagcactgctaatgggaatgtgctctctgccctgcatggggtc
tggcggtcacaggggctggcaggattatttgcaggtgtcttccctcgaatggcagccatc
agtctgggaggtttcatctttctgggggcttatgaccgaacgcacagcttgctgttggaa
gttggcagaaagagtccttga

DBGET integrated database retrieval system