KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100596002
Entry
100596002         CDS       T03265                                 

Gene name
ELK1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04510  Focal adhesion
nle04910  Insulin signaling pathway
nle04912  GnRH signaling pathway
nle04921  Oxytocin signaling pathway
nle05140  Leishmaniasis
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05213  Endometrial cancer
nle05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100596002 (ELK1)
   04012 ErbB signaling pathway
    100596002 (ELK1)
   04014 Ras signaling pathway
    100596002 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100596002 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100596002 (ELK1)
   04912 GnRH signaling pathway
    100596002 (ELK1)
   04921 Oxytocin signaling pathway
    100596002 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100596002 (ELK1)
   05205 Proteoglycans in cancer
    100596002 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100596002 (ELK1)
   05213 Endometrial cancer
    100596002 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100596002 (ELK1)
   05161 Hepatitis B
    100596002 (ELK1)
   05163 Human cytomegalovirus infection
    100596002 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100596002 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100596002 (ELK1)
Transcription factors [BR:nle03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100596002 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 100596002
NCBI-ProteinID: XP_030662831
Ensembl: ENSNLEG00000003420
LinkDB
Position
X
AA seq 428 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPTAVH
AAPGDTASGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPNAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGMPARLPAVVMDTAGQAGGH
AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctgagggagcaaggcaat
ggccacatcatctcctggacttcacgggatggtggtgaattcaagctggtggatgcagag
gaggtggcccggctgtgggggctacgcaagaacaagaccaacatgaattacgacaagctc
agccgggccttgcggtactactatgacaagaacatcatccgcaaggtgagcggccagaag
ttcgtctacaagtttgtgtcctaccctgaggtcgcagggtgctccactgaggactgcccg
ccccagccagaggtgtctgttacctccaccatgccaaatgtggcccccactgctgtacat
gctgccccaggggacactgcctctggaaagccaggcacacccaagggtgcaggaatggca
ggcccaggcggtttggcgcgcagcagccggaacgagtacatgcgctcgggcctctattcc
accttcaccatccagtctctgcagccacagccaccccctcatcctcggcctgctgtggtg
ctccccaatgcagctcctgcaggggcagcagcgcccccctcggggagcaggagcaccagt
ccaagccccctggaggcctgcctggaggctgaagaggccggcttgcctctgcaagtcatc
ctgaccccgcccgaggccccaaacctgaaatcggaagagctgaatgtggagccgggtttg
ggccgggctttgcccccagaagtgaaagtagaagggcccaaggaagagttggaagttgcg
ggggagagagggtttgtgccagaaaccaccaaggcagagccagaagtccctccacaggag
ggcatgccagcccggctgcccgcggtcgttatggacaccgcagggcaggcgggcggccac
gcggcttccagccctgagatctctcagccgcagaagggccggaagccccgggacctagag
cttccactcagcccgagcctgctaggtgggccgggacccgaacggaccccaggatcggga
agtggctccggcctccaggcaccggggccggcgctgaccccgtccctgcttcctacgcat
acattgaccccggtgctgctgacacccagctcgctgcctcccagcattcacttctggagc
accctgagtcccattgcgccccgtagcccggccaagctctccttccagtttccatccagt
ggcagcgcccaggtgcacatcccttccatcagtgtggatggcctctcgacccccgtggtg
ctctccccagggccccagaagccatga

DBGET integrated database retrieval system