KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100596627
Entry
100596627         CDS       T03265                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1 isoform X1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04015  Rap1 signaling pathway
nle04371  Apelin signaling pathway
nle04390  Hippo signaling pathway
nle04514  Cell adhesion molecules
nle04520  Adherens junction
nle05100  Bacterial invasion of epithelial cells
nle05200  Pathways in cancer
nle05213  Endometrial cancer
nle05216  Thyroid cancer
nle05218  Melanoma
nle05219  Bladder cancer
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100596627 (CDH1)
   04390 Hippo signaling pathway
    100596627 (CDH1)
   04371 Apelin signaling pathway
    100596627 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100596627 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100596627 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100596627 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100596627 (CDH1)
   05216 Thyroid cancer
    100596627 (CDH1)
   05218 Melanoma
    100596627 (CDH1)
   05219 Bladder cancer
    100596627 (CDH1)
   05213 Endometrial cancer
    100596627 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100596627 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100596627 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:nle04515]
    100596627 (CDH1)
   04090 CD molecules [BR:nle04090]
    100596627 (CDH1)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100596627 (CDH1)
Cell adhesion molecules [BR:nle04515]
 Cadherins
  Major cadherins
   100596627 (CDH1)
CD molecules [BR:nle04090]
 Proteins
  100596627 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 Cadherin_3
Other DBs
NCBI-GeneID: 100596627
NCBI-ProteinID: XP_030650721
Ensembl: ENSNLEG00000005326
LinkDB
Position
2
AA seq 882 aa
MGPWSLSLSALLLLLQVSSWLCQEPEPCHPGFDAKSYTFTVPRRHLERGRVLGRVSFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLQFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDREHIATYTLFSHAVSSNGN
AVEDPMEIVITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINKNTGVISVVTTGLDRESFPTYTLVVQAADLQGDGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDND
GQFVVTTNPANNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAREPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDRENFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgggtccttggagcctcagcctctcggcgctgctgctgctgctgcaggtctcctcttgg
ctctgccaggagccggagccctgccaccccggctttgacgccaagagctacacgttcacg
gtgccccggcgccacttggagagaggccgcgtcctgggcagagtgagttttgaagattgc
accggtcgacaaaggacagcctatttttccctcgacacccgattcaaagtgggcacagat
ggtgtgattacagtcaaaaggcctttacagtttcataacccacagatccatttcttggtc
tacgcctgggactccacctacagaaagttttccaccaaagtcacgctgaatacggtgggg
caccaccaccgccccccgccccatcaggcctctgtttctggaatccaagcagaattgctc
acatttcccaactcttctcctggcctcagaagacagaagagagactgggttattcctccc
atcagctgcccagaaaatgaaaaaggcccatttcctaaaaacctggttcagatcaaatcc
aacaaagacaaagaaggcaaggttttctacagcatcactggccaaggagctgacacaccc
cctgttggtgtctttattattgaaagagaaacaggatggctgaaggtgacagagcctctg
gatagagaacacattgccacatacactctcttctctcatgctgtgtcatccaacgggaat
gcagttgaggacccaatggagattgtgatcacggtgaccgatcagaatgacaacaagccc
gaattcacccaggaggtctttaaggggtctgtcatggaaggtgctcttccaggaacctct
gtgatggaggtcacagccacagacgcagacgatgatgtgaacacttacaatgccgccatc
gcttacaccatcctcagccaagatcctgagctgcctgacaaaaatatgttcaccattaac
aagaacacaggagtcatcagtgtggtcaccactgggctggaccgagagagtttccctacg
tataccctggtggttcaagctgctgaccttcaaggtgatgggttaagcacaacagcaaca
gctgtgatcacagtcactgacaccaacgataaccctccgatcttcaatcccaccacgtac
aagggtcaggtgcctgagaacgaggctaatgtcgtaatcaccacactgaaagtgactgat
gctgatgcccccaataccccagcgtgggaggctgtatacaccatattgaatgataatgac
ggacaatttgtcgtcaccacaaatccagcgaacaacgatggcattttgaaaacagcaaag
ggcttggattttgaggccaagcagcagtacattctacacgtagcagtgacgaatgtggtg
ccttttgaggtctctctcaccacctccacagccaccgtcaccgtggatgtgctggatgtg
aatgaagcccccatctttgtgcctcctgaaaagagagtggaagtgtccgaggactttggc
gtgggccaggaaatcacatcctacactgcccgggagccagacacatttatggaacagaaa
ataacgtatcggatttggagagacactgccaactggctggagattaatccggacactggt
gccatttccactcgggctgagctggacagggagaattttgagcacgtgaagaacagcacg
tacacagccctcatcatagctacagacaacggttctccagttgctactggaacagggaca
cttctgctgatcctgtctgatgtgaatgacaatgcccccataccagaacctcgaactata
ttcttctgtgagaggaatccaaagcctcaggtcataaacatcattgatgcagaccttcct
cccaatacatctcccttcacagcagaactaacacatggggcgagtgccaactggaccatt
cagtacaacgacccaacccaagaatctatcattttgaagccaaagatggccttagaggtg
ggtgactacaaaatcaacctcaagctcatggataaccagaataaagaccaagtgaccacc
ttagaggtcagcgtgtgtgactgtgaaggggccgccggcgtctgtagaaaggcacagcct
gtcgaagcaggattgcaaattcctgccattctggggattcttggaggaattcttgctttg
ctaattctgattctgctgctcttgctgtttcttcggaggagagcggtggtcaaagagccc
ttactgcccccagaggatgacacccgggacaacgtttattactatgatgaagaaggaggc
ggagaagaggaccaggactttgacttgagccagttgcacaggggcctggacgctcggcct
gaagtgactcgtaacgacgtcgcaccaaccctcatgagtgtcccccggtaccttccccgc
cctgccaatcccgatgaaattggaaattttattgatgaaaatctgaaggcggctgatact
gaccccacagccccgccttatgattctctgctcgtgtttgactatgaaggaagtggttcc
gaagctgctagtctgagctccttgaactcctcagagtcagacaaagaccaggactatgac
tacttgaacgaatggggcaatcgcttcaagaagctggccgacatgtacggaggcggcgag
gacgactag

DBGET integrated database retrieval system