KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100597165
Entry
100597165         CDS       T03265                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 isoform X1
  KO
K05430  interleukin 4
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04060  Cytokine-cytokine receptor interaction
nle04151  PI3K-Akt signaling pathway
nle04630  JAK-STAT signaling pathway
nle04640  Hematopoietic cell lineage
nle04657  IL-17 signaling pathway
nle04658  Th1 and Th2 cell differentiation
nle04659  Th17 cell differentiation
nle04660  T cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04672  Intestinal immune network for IgA production
nle05140  Leishmaniasis
nle05200  Pathways in cancer
nle05310  Asthma
nle05320  Autoimmune thyroid disease
nle05321  Inflammatory bowel disease
nle05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100597165 (IL4)
   04151 PI3K-Akt signaling pathway
    100597165 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100597165 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100597165 (IL4)
   04660 T cell receptor signaling pathway
    100597165 (IL4)
   04658 Th1 and Th2 cell differentiation
    100597165 (IL4)
   04659 Th17 cell differentiation
    100597165 (IL4)
   04657 IL-17 signaling pathway
    100597165 (IL4)
   04664 Fc epsilon RI signaling pathway
    100597165 (IL4)
   04672 Intestinal immune network for IgA production
    100597165 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100597165 (IL4)
  09163 Immune disease
   05310 Asthma
    100597165 (IL4)
   05320 Autoimmune thyroid disease
    100597165 (IL4)
   05321 Inflammatory bowel disease
    100597165 (IL4)
   05330 Allograft rejection
    100597165 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100597165 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nle04052]
    100597165 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100597165 (IL4)
Cytokines and growth factors [BR:nle04052]
 Cytokines
  Interleukins
   100597165 (IL4)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Haparin
  Cytokines
   100597165 (IL4)
SSDB
Motif
Pfam: IL4 HMW1C_N Mannosyl_trans3 RNA_polI_A14
Other DBs
NCBI-GeneID: 100597165
NCBI-ProteinID: XP_030679517
LinkDB
Position
2
AA seq 154 aa
MGLTSQLLPPLFFLLACAGNFVHGHNCDIALQEIIKTLNSLTEQKTLCTELTVTDIFAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATGRQFHRQHKQLIGFLKRLDRNLCGLAG
LNSCPVKEANQSTLEDFLERLKTIMREKYSKCSS
NT seq 465 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccagctgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgtccacggacacaactgcgatatcgccttacaggagatcatcaaaactttgaacagc
ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatctttgctgcctcc
aagaacacaactgagaaggaaactttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcgactggacggcagttccacaggcag
cacaagcagctgatcggattcctgaaacggctcgacaggaacctctgcggcctggcgggc
ttgaattcctgtcctgtgaaggaagccaaccagagtacgttggaagacttcttggaaagg
ctaaagacgatcatgagagagaaatattcaaagtgttcgagctga

DBGET integrated database retrieval system