KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100597173
Entry
100597173         CDS       T03265                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01524  Platinum drug resistance
nle04115  p53 signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04215  Apoptosis - multiple species
nle04370  VEGF signaling pathway
nle04919  Thyroid hormone signaling pathway
nle05010  Alzheimer disease
nle05012  Parkinson disease
nle05014  Amyotrophic lateral sclerosis
nle05016  Huntington disease
nle05020  Prion disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05134  Legionellosis
nle05145  Toxoplasmosis
nle05152  Tuberculosis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05210  Colorectal cancer
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05215  Prostate cancer
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100597173 (CASP9)
   04151 PI3K-Akt signaling pathway
    100597173 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100597173 (CASP9)
   04215 Apoptosis - multiple species
    100597173 (CASP9)
   04115 p53 signaling pathway
    100597173 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100597173 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100597173 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100597173 (CASP9)
   05212 Pancreatic cancer
    100597173 (CASP9)
   05215 Prostate cancer
    100597173 (CASP9)
   05213 Endometrial cancer
    100597173 (CASP9)
   05222 Small cell lung cancer
    100597173 (CASP9)
   05223 Non-small cell lung cancer
    100597173 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100597173 (CASP9)
   05012 Parkinson disease
    100597173 (CASP9)
   05014 Amyotrophic lateral sclerosis
    100597173 (CASP9)
   05016 Huntington disease
    100597173 (CASP9)
   05020 Prion disease
    100597173 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    100597173 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100597173 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100597173 (CASP9)
   05152 Tuberculosis
    100597173 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100597173 (CASP9)
   05161 Hepatitis B
    100597173 (CASP9)
   05160 Hepatitis C
    100597173 (CASP9)
   05164 Influenza A
    100597173 (CASP9)
   05162 Measles
    100597173 (CASP9)
   05168 Herpes simplex virus 1 infection
    100597173 (CASP9)
   05163 Human cytomegalovirus infection
    100597173 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100597173 (CASP9)
   05169 Epstein-Barr virus infection
    100597173 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100597173 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100597173 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nle01009]
    100597173 (CASP9)
   01002 Peptidases and inhibitors [BR:nle01002]
    100597173 (CASP9)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100597173 (CASP9)
Protein phosphatases and associated proteins [BR:nle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100597173 (CASP9)
Peptidases and inhibitors [BR:nle01002]
 Cysteine peptidases
  Family C14: caspase family
   100597173 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2 AsiA
Other DBs
NCBI-GeneID: 100597173
NCBI-ProteinID: XP_003279998
Ensembl: ENSNLEG00000007614
UniProt: A0A2I3GAX9
LinkDB
Position
24
AA seq 421 aa
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEVVRPEI
RKPEVLRLETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRES
GLRTRTGSNIDCEKLRRRFSSLHFMVKVKGDLTAKEMVLALLELARQDHGALDCCVVVIL
SHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHG
FEVASTSPEDESPGSNPEPDAMPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWR
DPKSGSWYVETLDDIFEQWARSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKT
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggacgaagcggaccggcggctcctgcggcggtgccggctgcggctggtggaggagctg
caggtggaccagctctgggacgccctgctgagccgcgagctgttcaggccccacatgatc
gaggacatccagcgggcaggctctggatctcggcgggatcaggccaggcagctgatcata
gatctagagactcgagggagtcaggctcttcctttgttcatctcctgcttagaggacaca
ggccaggacatgctggcttcatttctgcgaactaacaggcaagcagcaaagttgtcgaag
ccaaccctagaaaaccttaccccagtggtgctcagaccagaggttgtcagaccagagatt
cgcaaaccagaggttctcagactggaaacacccagaccagtggacattggttctggagga
ttcggtgatgtcggtgctcttgagagtttgaggggaaatgcagatttggcttacatcctg
agcatggagccctgtggccactgcctcattatcaacaatgtgaacttctgtcgtgagtcc
gggctccgcacccgcactggctccaacattgactgtgagaagttgcggcgccgcttctcc
tcgctgcatttcatggtgaaggtgaagggcgacctgactgccaaggaaatggtgctggct
ttgctggaactggcgcggcaggaccacggtgctctggactgctgcgtggtggtcattctc
tctcacggctgtcaggccagccacctgcagttcccaggggctgtctacggcacagatgga
tgccctgtgtcggtcgagaagattgtgaacatcttcaatgggaccagctgccccagcctg
ggagggaagcccaagctctttttcatccaggcctgtggtggggagcagaaagaccatggg
tttgaggtggcctccacttcccctgaagatgagtcccctggcagtaaccctgagccagac
gccatgccgttccaggaaggtttgaggaccttcgaccagctggacgccatatctagtttg
cccacacccagtgacatctttgtgtcctactctactttcccaggttttgtttcctggagg
gaccccaagagtggctcctggtatgttgagaccctggacgacatctttgagcagtgggct
cgctctgaagacctgcagtccctcctgctcagggtcgctaatgctgtttcggtgaaaggg
atttataaacagatgcctggttgctttaacttcctccggaaaaaacttttctttaaaacg
tcataa

DBGET integrated database retrieval system