KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100597416Help
Entry
100597416         CDS       T03265                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle05164  Influenza A
nle05202  Transcriptional misregulation in cancer
nle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    100597416 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    100597416 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    100597416 (TMPRSS2)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100597416 (TMPRSS2)
Peptidases [BR:nle01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100597416 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 100597416
NCBI-ProteinID: XP_003280442
LinkDB All DBs
Position
25
AA seq 529 aa AA seqDB search
MPPAPPRGESGCEERGAAGHIEHSRYLSLLDAVDKSKMALNSGSPPGFGPYYENHGYQPE
NPYPAQPTVAPSVYEVHPAQYYPSPVPQYAPRVLTQASNPVVRTQPQSPSGTVCTSKTKK
ALCITLTLGAFLVGAALAAGLLWKFMGSKCSDSGIECDSSGICISASNWCDGVSHCPSGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNSFYSSQGIVDD
SGATSFMKLNTSARNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGGSAR
LGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQPFLSYK
SGHQVEKVISHPNYDSKTKNNDIALMKLQTPLTFNDFVKPVCLPNPGLMLEPEQRCWISG
WGATEEKGKTSDELNAAMVRLIEMQRCNSRYVYDNLITPAMICAGFLQGTVDSCQGDSGG
PLVTSKDNVWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWIYRQMRANG
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgccccctgccccgcccagaggtgaaagcgggtgtgaggagcgcggcgcggcaggtcat
attgaacattccagatacctatcattactcgatgctgttgataaaagcaagatggctttg
aactcagggtcaccgccaggttttggaccttactatgaaaaccatggataccaaccggaa
aacccctatcccgcacagcccactgtggcccccagtgtctacgaggtgcatccggctcag
tactacccgtcccccgtgccccagtacgccccgagggtcctgacgcaggcttccaacccc
gtcgtccgcacgcagccccaatccccttcggggacagtgtgcacctcaaagactaagaaa
gcactgtgcatcaccttgaccctgggggccttcctcgtgggagctgcgctggccgctggc
ctactctggaagttcatgggcagcaagtgctccgactctgggatagagtgcgactcctca
ggtatctgcatcagcgcctctaactggtgcgatggcgtgtcacactgccccagcggggag
gacgagaaccggtgtgttcgcctctacggaccaaacttcatccttcaggtgtactcatct
cagaggaagtcctggcaccctgtgtgccaagatgactggaacgagaactatgggcgggcg
gcctgcagggacatgggctataagaatagtttttactctagccaaggaatagtggatgac
agcggagccaccagctttatgaaactgaacacaagtgcccgcaatgtcgatatctataaa
aaactgtaccacagtgatgcctgttcttcaaaagcagtggtttctttacgctgtatagcc
tgcggggtcaacttgaactcaagccgccagagcaggatcgtgggcggcgggagcgcgcgc
ctgggggcttggccctggcaggtcagcctgcatgtccagaacgtccatgtgtgcggaggc
tctatcatcacccccgagtggatcgtgacagccgcccactgcgtggaaaaacctcttaac
aatccatggcattggacggcatttgcggggattctgagacaacctttcctgtcctataaa
agcggacaccaagtagaaaaagtgatttctcatccaaattatgactccaagaccaaaaac
aatgacattgcgctgatgaagctgcagacgcctctgactttcaatgactttgtgaaacca
gtgtgtctgcccaacccaggcctgatgctggagccagaacagcgctgctggatttccggg
tggggggccaccgaggagaaagggaagacctcagacgagctgaacgctgccatggtgcgt
ctcattgagatgcagagatgcaacagcagatacgtctatgacaatctgatcaccccagcc
atgatctgtgctggcttcctgcaggggaccgtcgattcttgccagggtgacagtggaggg
cctctggtcacttcgaaagacaatgtctggtggctgatcggggatacaagctggggttct
ggctgtgccaaagcttacagaccaggagtgtacgggaatgtgacggtattcacggactgg
atttatcgccaaatgagggcaaacggctaa

DBGET integrated database retrieval system