KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100597454
Entry
100597454         CDS       T03265                                 

Gene name
KL
Definition
(RefSeq) klotho
  KO
K14756  klotho [EC:3.2.1.31]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00040  Pentose and glucuronate interconversions
nle00053  Ascorbate and aldarate metabolism
nle01100  Metabolic pathways
nle04211  Longevity regulating pathway
nle04928  Parathyroid hormone synthesis, secretion and action
nle04961  Endocrine and other factor-regulated calcium reabsorption
Module
nle_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100597454 (KL)
   00053 Ascorbate and aldarate metabolism
    100597454 (KL)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100597454 (KL)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100597454 (KL)
  09149 Aging
   04211 Longevity regulating pathway
    100597454 (KL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nle02000]
    100597454 (KL)
   04147 Exosome [BR:nle04147]
    100597454 (KL)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     100597454 (KL)
Transporters [BR:nle02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   100597454 (KL)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100597454 (KL)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-GeneID: 100597454
NCBI-ProteinID: XP_030674267
LinkDB
Position
9
AA seq 1012 aa
MPASAPPRRPRPPPPSLSLLLVLLALGGRRLRAEPGDGAQTWARFARPPAPEAAGLFQGT
FPDGFLWAAGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNANLPSGAQSPLQPA
TGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERL
RELGVQPVVTLYHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNP
YVVAWHGYATGRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
HWISPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESEKKFI
KGTADFFALSFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEYNHPQIFIVENGWFVS
GTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVD
FLSQDKTLLPKSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQ
FTDLNVYLWDVYHSKRLIKVDGVVTKKRKPYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
LIVPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPHLLARQGAWENP
YTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRH
AQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRDWLNQ
RNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLN
SPSQVAIVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
AHILDGINLCGYFAYSFNDRTAPRFGLYHYAADQFEPKASMKHYRKIIDSNGFLGPETLE
RVCPEEFTMCTECSFFHTRKSLLAFIAFLFFAFIISLSLIFYYSKKGRRSYK
NT seq 3039 nt   +upstreamnt  +downstreamnt
atgcccgccagcgccccgccgcgccgcccgcggccgccgccgccgtcgctgtcgctgctg
ctggtgctgctggccctgggcggccgccgcctgcgcgcggagccgggcgacggcgcgcag
acctgggcccgtttcgcgcggcctcccgcccccgaggccgcgggcctcttccagggcacc
ttccccgacggcttcctctgggccgcaggcagcgccgcctaccagaccgagggcggctgg
cagcagcacggcaagggtgcgtccatctgggacaccttcacccaccaccccctggcaccc
ccgggagactcccggaacgccaatctgccgtcgggcgcccagtcgccgctgcagcccgcc
accggggacgtggccagcgacagctacaacaacgtcttccgcgacacggaggcgctgcgc
gagctcggggtcacccactaccgcttctccatctcgtgggcgcgggtgctccccaatggc
agcgcgggcgtccccaaccgcgaggggctgcgctactaccggcgcctgctggagcggctg
cgggagctgggcgtgcagccggtggtcaccctgtaccactgggacctgccccagcgcctg
caggacgcctacggcggctgggccaaccgcgccctggccgaccacttcagggattacgcg
gagctctgcttccgccacttcggcggtcaggtcaagtactggatcaccatcgacaacccc
tacgtggtggcctggcacggctacgccaccgggcgcctggcccccggcatccggggcagc
ccgcggctcgggtacctggtggcgcacaacctcctcctggctcatgccaaagtctggcat
ctctacaatacttctttccgtcccactcagggaggtcaggtgtccattgccctaagctct
cactggatcagtcctcgaagaatgactgaccacagcatcaaagaatgtcaaaaatctctg
gactttgtactaggctggtttgccaaacccgtatttattgatggtgactatcccgagagc
atgaagaataacctttcatctattctgcctgattttactgaatctgagaaaaagttcatc
aaaggaactgctgacttttttgccctttcctttggacccaccttgagtttccaacttttg
gaccctcacatgaaattccgccaattggaatctcccaacctgaggcagctgctttcctgg
attgaccttgaatataaccatcctcaaatatttattgtggaaaatggctggtttgtctca
gggaccaccaagagagatgatgccaaatatatgtattacctcaaaaagttcatcatggaa
accttaaaagccatcaagctggatggggtggatgtcatcgggtacaccgcgtggtccctc
atggatggtttcgagtggcacagaggttacagcatcaggcgtggactcttctatgttgac
tttctaagccaggacaagacgttgttgccaaagtcttcagccttgttctaccaaaagctg
atagagaaaaatggcttccctcctttacctgaaaatcagcccctagaagggacatttccc
tgtgactttgcttggggagttgttgacaactacattcaagtagataccactctgtctcag
tttaccgacctgaatgtttacctgtgggatgtctaccacagtaaaaggcttattaaagtg
gatggggttgtgaccaagaagaggaaaccctactgtgttgactttgctgccatccagccc
cagatcgctttactgcaggaaatgcacgtcacacattttcgcttctccctggactgggcc
ctgattgtccctctgggtaaccagtcccaggtgaaccacaccatcctgcagtactatcgc
tgcatggccagcgagcttgtccgtgtcaacatcaccccggtggtggccctgtggcagcct
atggccccgaaccaaggactgccacacctcctggccagacagggcgcctgggagaacccc
tacactgccctggcctttgcagagtatgcccgactgtgctttcaagagctcggccatcac
gtcaagctttggataacgatgaatgagccatatacaaggaacatgacatacagtgccggc
cacaaccttctgaaggcccatgccctggcttggcatgtgtacaatgaaaagtttaggcat
gctcagaatgggaaaatatccatagccttgcaggctgattggatagaacctgcctgccct
ttctcccaaaaggacaaagaggtggccgagagagttttggaatttgacattggctggctg
gctgagcccattttcggctctggagattatccatgggtgatgagggactggctgaaccaa
agaaacaattttcttcttccttatttcactgaagatgaaaaaaagctaatccagggtacc
tttgactttttggctttaagccattataccaccatccttgtggactcggaaaaagaagat
ccaataaaatacaatgattacctggaagtgcaggaaatgaccgacatcacgtggctcaac
tcccccagtcaggtggcgatagtgccctgggggttgcgcaaagtgctcaattggctgaag
ttcaagtacggagacctcccaatgtacataatatccaacggaatcgatgacgggctgcat
gctgaggacgaccagctgagggtgtattatatgcagaattacataaacgaagctctcaaa
gcccacatactggatggtatcaatctttgcggatactttgcttattcgtttaacgatcgc
acagcgccgaggtttggcctctatcattatgctgcagatcagtttgagcccaaggcatcc
atgaaacattacaggaaaattattgacagcaatggtttcctgggcccagaaactctggaa
agagtttgtccagaagaattcaccatgtgtactgagtgcagtttttttcacacccgaaag
tctttactggctttcatagctttcctattttttgcttttattatttctctctcccttata
ttttactactcgaagaaaggcagaagaagttacaaatag

DBGET integrated database retrieval system