KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100597733Help
Entry
100597733         CDS       T03265                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00350  Tyrosine metabolism
nle01100  Metabolic pathways
Module
nle_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:nle00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100597733 (GSTZ1)
Enzymes [BR:nle01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100597733 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 100597733
NCBI-ProteinID: XP_003260846
UniProt: G1S452
LinkDB All DBs
Position
22a
AA seq 216 aa AA seqDB search
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVP
ALKIDGITIYQSLAIIEYLEETRPTPQLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLK
QVGEEIQLTWAQNAITSGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDL
TPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggggaagcccatcctctattcctatttccgaagctcctgctcatggagagtt
cgaattgctctggccttgaaaggcattgactacgagacggtgcccatcaatctcataaag
gatgggggccaacagttctctaaggacttccaggcactgaatcccatgaagcaggtgcca
gccttgaagattgatggaatcaccatttaccagtcactggccatcattgagtatcttgag
gagacgcgtcccactccgcaacttctgcctcaggacccaaagaagagggccagcgtgcgt
atgatttctgacctcatcgctggtggcatccagcccctgcagaacctgtctgtcctgaag
caagtaggagaggagatccagctgacctgggcccagaatgccatcacttctggctttaac
gccctggagcagatcctacagagcacagcaggcatctactgtgtaggagatgaggtgacc
atggctgatctgtgcttggtgcctcaggtggcaaatgctgaaagattcaaggtggatctc
accccctaccctaccatcagctccatcaacaagaggctgctggtcttggaggccttccag
gtgtctcacccctgccggcagccagatacacccaccgagctgagggcctag

DBGET integrated database retrieval system