KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100598020
Entry
100598020         CDS       T03265                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04022  cGMP-PKG signaling pathway
nle04141  Protein processing in endoplasmic reticulum
nle04151  PI3K-Akt signaling pathway
nle04211  Longevity regulating pathway
nle04261  Adrenergic signaling in cardiomyocytes
nle04668  TNF signaling pathway
nle04728  Dopaminergic synapse
nle04911  Insulin secretion
nle04915  Estrogen signaling pathway
nle04918  Thyroid hormone synthesis
nle04925  Aldosterone synthesis and secretion
nle04926  Relaxin signaling pathway
nle04927  Cortisol synthesis and secretion
nle04928  Parathyroid hormone synthesis, secretion and action
nle04934  Cushing syndrome
nle04935  Growth hormone synthesis, secretion and action
nle05020  Prion disease
nle05030  Cocaine addiction
nle05031  Amphetamine addiction
nle05034  Alcoholism
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100598020 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100598020 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100598020 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100598020 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100598020 (ATF6B)
   04915 Estrogen signaling pathway
    100598020 (ATF6B)
   04926 Relaxin signaling pathway
    100598020 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100598020 (ATF6B)
   04918 Thyroid hormone synthesis
    100598020 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100598020 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100598020 (ATF6B)
   04927 Cortisol synthesis and secretion
    100598020 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100598020 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100598020 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100598020 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100598020 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100598020 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100598020 (ATF6B)
   05031 Amphetamine addiction
    100598020 (ATF6B)
   05034 Alcoholism
    100598020 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100598020 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100598020 (ATF6B)
   05161 Hepatitis B
    100598020 (ATF6B)
   05163 Human cytomegalovirus infection
    100598020 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100598020 (ATF6B)
Transcription factors [BR:nle03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100598020 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 100598020
NCBI-ProteinID: XP_003272184
Ensembl: ENSNLEG00000006562
LinkDB
Position
22a
AA seq 711 aa
MFGGWGGKMAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEDQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPS
SEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETIQINVVPTSDDSSDVQTKIEPVSPCS
SINSEASLLSADSSSQAFIGEEVLEVKTESLSHSRCLLWDVPAPSLGAVQISMGPSPDGS
SGKALPTRKPPLQPKPVVLTTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAPSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPISPRMNKGEPQPRRHLLGFSEQEPVHGVEPLQGSSQGPKEPQPSPTDQP
SFSNLTAFPGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHQPLYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgtttggggggtgggggggaaagatggcggagctgatgctcctcagcgagattgctgac
cctacgcgtttcttcaccgacaacctgcttagcccggaggactggggtctgcagaacagc
accttgtattctggcctagatgaagtggccgaggaccagacgcagctcttccgttgcccg
gagcaggatgtcccgtttgacggcagctccctggacgtggggatggatgtcagcccgcct
gagcccccatgggaactcctgccgatcttcccagatcttcaggtgaagtctgagccatct
tccccctgctcttcctcctccctcagctccgagtcatcacgtctctccacagagccatcc
agcgaggctcttggggtaggggaggtgctccatgtgaagacagagtccttggcaccccca
ctgtgtctcctgggagatgacccaacatcctcatttgaaaccatccagatcaacgtagtc
cccacctctgatgattcctcagatgtccagaccaagatagaacctgtctctccatgttct
tccatcaactctgaggcctccctgctctcagctgactcctctagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccctgtcccattcaagatgcctcctgtgggat
gtcccagccccctcacttggagctgtccagatcagcatgggcccatcccctgatggctct
tcagggaaagccctgcccacccggaagccgccactgcagcccaaacctgtggtgctaacc
actgtcccaatgccacccagagctgtgcctcccagcaccaccgtccttctgcagcccctc
gtccagccacccccagtgtccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccggcaccctctctaccacggcctgagaggaagagcatcgttcccgctcctatg
cctggaaactcctgcccacctgaagtggatgcaaaactgctgaagcggcagcagcgaatg
atcaagaaccgggagtcagcctgccagtcccggagaaagaagaaagagtatctgcaggga
ctggaggctcggctgcaggcagtactggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagcgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cccgtcagcatcagtgagcctccttcagctcccatctctcctcggatgaacaagggggag
cctcaaccccggagacacttgctggggttctcagagcaagagccagttcatggagttgaa
cctctccaggggtcctcccagggccctaaggagccccagcccagccccacagaccagccc
agtttcagcaacctgacagccttccctgggggcaccaaggagctactactaagagaccta
gaccagctcttcctctcctctgattgccggcacttcaaccgcaccgagtccctgaggctt
gctgatgagttgagcggctgggtccagcgccaccagagaggccggcggaagatccctcag
agggcccaggagagacagaagtctcagccacggaagaagtcacctccagttaaggcagtc
cccatccaaccccctggacccccggaaagggattctgtgggccagctgcagctatatcgc
cacccagaccgttcgcagccagcgttcttggatgcaattgaccgacgggaagacacattt
tatgttgtctctttccgaagggaccacctgctgctcccagccatcagccacaacaagacc
tcccggcccaagatgtccctggtgatgcctgccatggcccccaatgagaccctgtcaggc
cgtggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacagtgcccccctcgctccgaaaacagccatcccca
accccaggcaatgccacaggtggccccttgccagcctctgcagccagccaggcccaccag
gcctcccaccagcccctctacctcaatcatccctga

DBGET integrated database retrieval system