KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100598341
Entry
100598341         CDS       T03265                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle03460  Fanconi anemia pathway
nle05169  Epstein-Barr virus infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05210  Colorectal cancer
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05216  Thyroid cancer
nle05217  Basal cell carcinoma
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100598341 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100598341 (POLK)
   05202 Transcriptional misregulation in cancer
    100598341 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100598341 (POLK)
   05212 Pancreatic cancer
    100598341 (POLK)
   05225 Hepatocellular carcinoma
    100598341 (POLK)
   05226 Gastric cancer
    100598341 (POLK)
   05214 Glioma
    100598341 (POLK)
   05216 Thyroid cancer
    100598341 (POLK)
   05220 Chronic myeloid leukemia
    100598341 (POLK)
   05217 Basal cell carcinoma
    100598341 (POLK)
   05218 Melanoma
    100598341 (POLK)
   05213 Endometrial cancer
    100598341 (POLK)
   05224 Breast cancer
    100598341 (POLK)
   05222 Small cell lung cancer
    100598341 (POLK)
   05223 Non-small cell lung cancer
    100598341 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100598341 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nle03400]
    100598341 (POLK)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100598341 (POLK)
DNA repair and recombination proteins [BR:nle03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100598341 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 100598341
NCBI-ProteinID: XP_003266124
Ensembl: ENSNLEG00000005220
UniProt: G1QZI9
LinkDB
Position
18
AA seq 870 aa
MDSTKEKCDSYKDDLLLRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQV
NQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRNLSNTIVHIDMDAFYAAVEMRDN
PELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYQAVSKE
VKEILADYDPNFMAMSLDEAYLNITKHLEERQNWPEDKRRYFIKMGNSVENDNPGKEVNK
LSEHERSISPLLFEESPSDLQPPGDPFQVNFEEQNKPQILQNSVVFGTSAEEVVKEIRFR
IEQKTALTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKV
TEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLTRDGERKSMSVER
TFSEINKAEEQYSLCQELCSELAQDLQKERLKGRTVTIKLKNVNFEVKTRASTVSSVVST
AEEIFAIAKELLKTEIDADFPHPLRLRLMGVRISSFPNEEDRKHQQRSIIGFLHAGNQAL
SATGCILEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCVAVNKQSFQTSQPFQ
VLKKMNENLEISENSDDCQIFTCPVCFRAQGCISLEALNKHVDECLDGPSISENFKMFSC
SRVSATKVNKKENVPDSSPCEKQDYEAHPKIKEIPSVDGVALVDTIDNSSKAESIDALIN
KHSKEECSSLPSKSFNIEHCRQNSSCTVSLENEDVGSLSRQEYCQPYLCEVKTDQALVCP
VCNVEQKTSDLTLFNVHVDVCLNKSFIQELRKDKVNPLNQPKESSRSTGSSSGVQKSVTR
TKRPGLMTKYSTSKKIKPNNPKHTLDIFFK
NT seq 2613 nt   +upstreamnt  +downstreamnt
atggatagcacaaaggagaagtgtgacagttacaaggatgatcttctgcttaggatggga
cttaatgataataaagcaggaatggaaggattagataaagagaaaattaacaaaattata
atggaagccacaaaggggtccagattttatggaaatgagctcaagaaagaaaagcaagtc
aaccaacgaattgaaaatatgatgcaacaaaaagctcaaatcaccagccaacagctaaga
aaagcacaattacaggttgacagatttgcaatggaattagaacagagccgaaatttgagc
aataccatagtgcacattgacatggatgctttctatgcagctgtagaaatgagggacaat
ccagaattgaaggataaacccattgctgtaggatcaatgagtatgctgtctacttcaaat
taccatgcaaggaggtttggtgttcgtgcagccatgccaggatttattgctaagagactg
tgcccacaacttataatagtgcccccaaactttgacaaataccaagctgtgagtaaagag
gttaaggaaatacttgctgattatgatcccaattttatggccatgagtcttgacgaagcc
tacttgaatataacaaagcacttagaagaaagacaaaattggcctgaggataaaagaagg
tatttcatcaaaatgggaaactctgtagaaaatgataatccaggaaaggaagttaataaa
ctgagtgagcatgaacgatccatctctccactactttttgaagagagtccttctgatttg
cagcccccaggagatcctttccaagtgaactttgaagaacaaaacaaacctcaaatactc
caaaactcagttgtttttggaacatcagccgaggaagtggtaaaggaaattcgtttcaga
attgagcagaaaacagcactgacagccagtgcaggcattgccccaaatacaatgttagca
aaagtatgcagtgataagaataaaccgaatggacaataccaaattcttcccaatagacaa
gctgtgatggacttcatcaaggatttacccattagaaaggtttctggaataggaaaagtt
acagagaaaatgttaaaggcccttggaattattacatgtacagaactttaccaacagagg
gcattgctctctctccttttctctgaaacatcttggcattatttccttcatatctccttg
ggtctaggttcaacacacctgacaagggatggagagaggaaaagtatgagcgttgagagg
acgttcagtgagataaataaagcggaagaacaatacagcctatgtcaggaactttgcagt
gaacttgctcaagatctacagaaagaaagacttaagggtagaactgttaccattaagttg
aagaatgtgaattttgaagtaaaaactcgtgcatctacagtttcatctgttgtttctact
gcagaagaaatatttgccattgctaaagaattgctaaaaacagaaattgatgctgatttt
ccacatcccttgagattaagacttatgggtgttcggatatctagttttcccaatgaagaa
gacaggaaacaccaacaaaggagcattattggctttttacatgctggaaaccaagccctg
tcagccactgggtgtatactagagaaaactgacaaagataagtttgtaaaacctctagaa
atgtctcataagaagagtttctttgataaaaaacgatcagaaaggaaatggagtcaccaa
gatacatttaaatgtgtagccgtgaataaacaaagtttccagacatcacaaccattccaa
gttttaaagaagatgaatgagaatttggaaatatcagagaattcagatgactgtcagata
tttacctgtcctgtttgctttagggcacaagggtgcatcagtctggaagccttgaataaa
catgtagatgaatgtcttgatggaccttcaatcagtgaaaactttaaaatgttctcgtgt
tcacgtgtttctgccaccaaagttaacaagaaagaaaatgttcctgattcttcaccttgt
gagaagcaagattatgaagcccatccaaaaattaaagaaataccttcagtagatggtgta
gctttagtagatactatagataactcatctaaagcagaaagcatagatgctttaattaat
aagcacagcaaggaagaatgttctagtctcccaagcaagtcttttaatattgaacactgt
cgtcagaattcttcttgtactgtttcattggaaaacgaagatgttggatcattaagtaga
caagagtactgccagccttacttatgtgaagtgaaaacagaccaagctctagtttgtcct
gtttgtaacgtagaacaaaagacttcagatctaaccctgttcaatgtgcatgtggatgtt
tgcttaaataaaagttttatccaagaattaagaaaggataaagttaacccacttaatcaa
cctaaagaaagctccagaagtactggtagctcaagtggagtacagaagtctgtaacaaga
acaaaaaggccaggattgatgacaaagtactcaacatcaaagaaaataaaaccaaacaat
cccaaacatacccttgatatattttttaagtaa

DBGET integrated database retrieval system