KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100598636Help
Entry
100598636         CDS       T03265                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100598636 (SUV39H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100598636 (SUV39H1)
Enzymes [BR:nle01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100598636 (SUV39H1)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100598636 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100598636 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 100598636
NCBI-ProteinID: XP_003276874
UniProt: G1R8Q1
LinkDB All DBs
Position
X
AA seq 423 aa AA seqDB search
MVGMSRLRNDRLADPLTGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLC
DYKKIREQEYYLVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRH
LDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVG
EGITLNQVAVGCECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCG
YDCPNRVVQKGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQI
YDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAF
FATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRK
YLF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggtggggatgagtcgcctgagaaatgacagactggctgacccactgacaggctgcagc
gtgtgttgcaagtcttcttggaatcagctgcaggacctgtgccgcctggccaagctctcc
tgccctgccctcggtatctctaagaggaatctctatgactttgaagtcgagtacctgtgc
gattataagaagatccgcgaacaggaatattacctggtgaaatggcgtggatatccagac
tcagagagcacctgggagccacggcagaatctcaagtgtgtgcgtatcctcaagcagttc
cacaaggacttagaaagggagctgctccggcggcaccaccggtcaaagaccccccggcac
ctggacccaagcttggccaactacctggtgcagaaggccaagcagaggcgggcgctccgt
cgctgggagcaggagctcaatgccaagcgcagccatctgggacgcatcactgtagagaat
gaggtggacctggacggccctccgcgggcctttgtgtacatcaatgagtaccgtgttggt
gagggcatcaccctcaaccaggtggctgtgggctgcgagtgccaggactgtctgtgggca
cccactggaggctgctgcccaggggcgtcactgcacaagtttgcctacaatgaccagggc
caggtgcggcttcgagccgggctgcccatctatgaatgcaactcccgctgccgctgcggc
tatgactgcccaaatcgcgtggtacagaagggcatccgatatgacctctgcatcttccgc
acggatgatgggcgcggctggggcgtccgcaccctggagaagattcgtaagaacagcttc
gtcatggagtacgtgggagagatcattacctcagaggaggcagagcggcggggccagatc
tacgaccgtcagggcgccacctacctctttgacctggactacgtggaggacgtgtacacc
gtggatgccgcctactatggcaacatctcccactttgtcaaccacagttgtgaccccaac
ctgcaggtgtacaacgtcttcatagacaaccttgacgagcggctgccccgcatcgctttc
tttgccacaagaaccatccgggcaggcgaggagctcacctttgattacaacatgcaagtg
gaccccgtggacatggagagcacccgcatggactccaactttggcctggctgggctccct
ggctcccctaagaagcgggtccgtattgaatgcaagtgtgggactgagtcctgccgcaaa
tacctcttctag

DBGET integrated database retrieval system