KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100601116Help
Entry
100601116         CDS       T03265                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00010  Glycolysis / Gluconeogenesis
nle00030  Pentose phosphate pathway
nle00051  Fructose and mannose metabolism
nle00052  Galactose metabolism
nle01100  Metabolic pathways
nle01200  Carbon metabolism
nle01230  Biosynthesis of amino acids
nle03018  RNA degradation
nle04152  AMPK signaling pathway
nle05230  Central carbon metabolism in cancer
Module
nle_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100601116 (PFKP)
   00030 Pentose phosphate pathway
    100601116 (PFKP)
   00051 Fructose and mannose metabolism
    100601116 (PFKP)
   00052 Galactose metabolism
    100601116 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100601116 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100601116 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    100601116 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nle01009]
    100601116 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nle03019]
    100601116 (PFKP)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100601116 (PFKP)
Protein phosphatases and associated proteins [BR:nle01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100601116 (PFKP)
Messenger RNA biogenesis [BR:nle03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100601116 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100601116
NCBI-ProteinID: XP_003257627
LinkDB All DBs
Position
9
AA seq 784 aa AA seqDB search
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAARNLLQRGIT
NLCVIGGDGSLTGANIFRKEWSGLLEELARNGQIDNEAVQKYAYSCVAWWVHRHIDNDFA
HDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RVLPGKYLDEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSVCVL
GISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggacgactcccgggcccccaagggctccttgcggaagttcctggaacacctc
tccggggccggcaaggccatcggcgtgctgaccagcggcggggatgctcaaggtatgaac
gctgccgtccgtgccgtggtgcgcatgggtatctacgtgggggccaaggtgtacttcatc
tacgagggctaccagggcatggtggacggaggctcgaacatcgcggaggctgactgggaa
agcgtctccagcatcctgcaagtgggtgggacgatcattggcagtgcacggtgccaggcc
ttccgcacacgggaaggccgcctgaaggctgcccgcaacctgctgcagcgcggcatcacc
aacctgtgtgtgatcggcggggacgggagcctcaccggggccaacatcttccggaaggag
tggagtgggctgctggaggagctggccaggaatggccagatcgataacgaggccgtgcag
aagtacgcctactcatgtgtggcatggtgggttcatcgacacatcgacaacgactttgcg
cacgacatgaccatcggcactgactccgcgctgcacaggatcatcgaggtggttgacgcc
atcatgaccacggcccagagccaccagaggaccttcgttctggaagtgatgggacgacac
tgtgggtacctggccctggtgagtgccttggcctgtggtgcagactgggtgttccttccg
gaatctccgccagaggaaggctgggaggagcagatgtgtgtcaaactctcggagaaccgt
gcccggaaaaaaaggctgaatattattattgtggccgaaggagcaattgatacccaaaat
aaacccattacctctgagaaaatcaaagagctcgttgtcacgcagctgggctacgacaca
cgtgtgaccatcctcgggcacgtgcagagaggggggaccccttcggcgttcgacaggatc
ttggccagccgcatgggagtggaggcggtcatcgccttgctagaggccaccccggacacc
ccagcttgtgtcgtgtcactgaatgggaaccacgccgtgcgcctgccgctgatggagtgc
gtgcagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagacgcagtt
cgactccgagggaggagctttgcgggcaacttgaacacctacaagcgacttgccatcaag
ctgccggatgatcagatcccaaagaccaattgcaacgtggctgtcatcaacgtgggggcg
cccgcggctgggatgaacgcagccgtacgctcagctgtgcgcgtgggcattgccgatggc
cacaggatgctcgccatctatgatggcttcgatggcttcgccaagggccagatcaaagaa
atcggctggacagatgtcgggggctggaccggccaaggaggctccattcttgggacaaaa
cgcgttctcccggggaagtacttggatgagattgccacacagatgcgcacacacagcatc
aacgcgctgctgatcatcggtggatttgaggcctacctgggactcctggagctgtcagcc
gcccgggagaagcacgaggagttctgtgtccccatggtcatggttcccgctactgtgtcc
aacaatgtgccgggttccgatttcagcatcggggcagacacagccctgaacactatcacc
gacacctgcgaccgcatcaagcagtccgccagcggaaccaagcggcgcgtgttcatcatc
gagaccatgggcggctactgcggctacctggccaacatggggggactcgcggccggagcc
gatgccgcatacattttcgaagagcccttcgacatcagggatctgcagtccaatgtggag
cacctgacggagaaaatgaagaccaccatccagagaggccttgtgctcagaaatgagagc
tgcagtgaaaactacaccaccgacttcatttaccagctctattcggaagagggcaaaggt
gtgtttgactgcaggaagaatgtgctgggccacatgcagcagggtggggcaccctctcca
tttgatagaaactttggaaccaaaatatctgccagagctatggagtggatcactgcgaaa
ctcaaggaggcccggggcagaggaaaaaaatttaccaccgatgattctgtttgtgtgctg
ggaataagcaaaagaaacgttatttttcaacctgtggcagagctgaagaagcaaacggat
tttgagcacaggattcccaaagagcagtggtggctcaagctacggcccctcatgaagatc
ctggccaagtacaaggctagctacgacgtgtcggactccggccagctggagcacgtgcag
ccctggagtgtctga

DBGET integrated database retrieval system