KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100601660Help
Entry
100601660         CDS       T03265                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00010  Glycolysis / Gluconeogenesis
nle00053  Ascorbate and aldarate metabolism
nle00071  Fatty acid degradation
nle00280  Valine, leucine and isoleucine degradation
nle00310  Lysine degradation
nle00330  Arginine and proline metabolism
nle00340  Histidine metabolism
nle00380  Tryptophan metabolism
nle00410  beta-Alanine metabolism
nle00561  Glycerolipid metabolism
nle00620  Pyruvate metabolism
nle01100  Metabolic pathways
Module
nle_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100601660 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    100601660 (ALDH2)
   00620 Pyruvate metabolism
    100601660 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100601660 (ALDH2)
   00561 Glycerolipid metabolism
    100601660 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100601660 (ALDH2)
   00310 Lysine degradation
    100601660 (ALDH2)
   00330 Arginine and proline metabolism
    100601660 (ALDH2)
   00340 Histidine metabolism
    100601660 (ALDH2)
   00380 Tryptophan metabolism
    100601660 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100601660 (ALDH2)
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100601660 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 100601660
NCBI-ProteinID: XP_012365464
LinkDB All DBs
Position
10
AA seq 422 aa AA seqDB search
MDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKRLRYYAGWADK
YHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTP
LTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAG
SSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEF
VERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGCINTGKQEGAKLLCGGGIAADRG
YFIQPTVFGDVXDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFAKDLDK
ANYLSQALQVGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQK
NS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacgcatcacacaggggccggctgctgaaccgcctggccgatctgatcgagcgggac
cggacttacctggcggccttggagaccctagacaatggcaagccctatgtcatctcctac
ctggtggatttggacatggtcctcaaacgtctccggtattatgccggctgggctgataag
taccacgggaaaaccattcccattgacggagacttcttcagctacacacgccatgaaccc
gtgggggtgtgcgggcagattattccgtggaatttcccactcctgatgcaagcatggaag
ctgggcccagccttggcgactggaaacgtggttgtgatgaaagtagctgagcagacgccc
ctcaccgccctctatgtggccaacttgatcaaggaggccggctttccccctggtgtggtc
aacattgtgcctggatttggccccactgctggggccgccattgcctcccatgaggatgtg
gacaaagtggcattcacaggctccaccgagattggccgcgtaatccaggttgctgctggg
agcagcaacctcaagagagtgaccctggagctgggggggaagagccccaacatcatcatg
tcagatgccgatatggattgggccgtggaacaggcccacttcgccctgttcttcaaccag
ggccagtgctgctgtgccggctcccggaccttcgtgcaggaggacatctatgatgagttt
gtggagcggagcgttgcccgggccaagtcccgagtggttgggaacccctttgatagcaag
accgagcaggggccgcaggtggatgaaactcagtttaagaagatccttggctgtatcaac
actgggaaacaagagggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggt
tacttcatccagcccaccgtgtttggagacgtgtaggatggcatgaccatcgccaaggag
gagatcttcgggccggtgatgcagatcctgaagttcaagaccatagaggaggttgttggg
agagccaacaattccacatacgggctggccgcagctgtcttcgcaaaggatttggacaag
gccaattacctgtcccaggccctccaggtgggcactgtgtgggtcaactgctatgatgtg
tttggagcccagtcaccctttggtggctacaagatgtcggggagtggccgggagctgggc
gagtacggcctgcaggcatacactgaagtgaaaactgtcacagtcaaagtgcctcagaag
aactcgtaa

DBGET integrated database retrieval system