KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100601695
Entry
100601695         CDS       T03265                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2 isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00564  Glycerophospholipid metabolism
nle00565  Ether lipid metabolism
nle01100  Metabolic pathways
nle04014  Ras signaling pathway
nle04024  cAMP signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04144  Endocytosis
nle04666  Fc gamma R-mediated phagocytosis
nle04724  Glutamatergic synapse
nle04912  GnRH signaling pathway
nle04928  Parathyroid hormone synthesis, secretion and action
nle05200  Pathways in cancer
nle05212  Pancreatic cancer
nle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100601695 (PLD2)
   00565 Ether lipid metabolism
    100601695 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100601695 (PLD2)
   04072 Phospholipase D signaling pathway
    100601695 (PLD2)
   04071 Sphingolipid signaling pathway
    100601695 (PLD2)
   04024 cAMP signaling pathway
    100601695 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100601695 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100601695 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100601695 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    100601695 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100601695 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100601695 (PLD2)
   05231 Choline metabolism in cancer
    100601695 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100601695 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100601695 (PLD2)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100601695 (PLD2)
Membrane trafficking [BR:nle04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100601695 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    100601695 (PLD2)
SSDB
Motif
Pfam: PX PLDc PLDc_2 PH PH_2
Other DBs
NCBI-GeneID: 100601695
NCBI-ProteinID: XP_003277913
Ensembl: ENSNLEG00000017410
UniProt: G1S6J5
LinkDB
Position
19
AA seq 933 aa
MTATPESLFPTGGELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQPLKVRPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKFRNFQELHRDLLRHKVL
MSLLPLARFAVAYSPARDAANREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSQLSFIPDLGCKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQAR
WWAQEITELAQGPGRDFLQLHQHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEVYLKRPAHSDDWRLDMMLKRKAEDGVRVSILLFKEVELALGINSGYSKRAL
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
SAACQPPTPCPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQ
CTTVQVLRSVDRWSAGTLENSILNAYLHTIRESRHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCYRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFSVILGANTRLDLDLRDPVCD
GFFQWWQDTAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQ
GHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgacggcgacccctgagagcctcttccccactgggggcgaactggactccagccagctc
cagatggagtccgatgaggtggacaccctgaaggagggagaggacccagccgaccggatg
cacccgtttctggccatctatgagcttcagcctctgaaagtgcgccccttggtgttcgca
cctggggtccctgtcacagcccaggtggtgggcacggaaagatataccagtggatccaag
gtgggaacctgcactctgtattctgtccgcttgactcacggcgacttttcctggacaacc
aagaagaaattccgtaattttcaggagttgcatcgggacctcctgagacacaaagtcttg
atgagtctgctccctctggctcgttttgccgttgcctattctccagcccgagatgcagcc
aacagagagatgccctctctaccccgggcaggtcctgagggctccaccagacatgcagcc
agcaaacagaaatacctggagaattacctcaaccgcctcttgaccatgtctttctatcgc
aactaccatgccatgacagagttcctggaagtcagtcagctgtcctttatcccagacttg
ggctgcaaaggactggaggggatgatccggaagcgctcaggtggccatcgcgttcctggc
ctcacctgctgtggccgagaccaagtttgttatcgctggtccaagaggtggctggtggtg
aaggactccttcctgctgtacatgtgcctcgagacgggtgccatctcatttgttcagctc
tttgaccctggctttgaggtgcaggtggggaaaaggagcacggaggcacggcacggcgtg
cggatcgacacctcccacaggtccttgattctcaagtgcagcagctaccggcaggcacgg
tggtgggcccaagagatcactgagctggcacaaggcccaggcagagacttcctacagctg
caccagcatgacagctacgccccaccccggcctgggaccttggcccggtggtttgtgaat
ggggcaggttactttgctgctgtggcagatgccatccttcgagcccaagaggagattttc
atcacagactggtggttgagtcctgaggtttacctgaagcgtccggcccattcagatgac
tggagactggacatgatgctcaagaggaaggcggaggacggtgtccgcgtgtccattctg
ctgtttaaggaagtggaattggccttgggcatcaacagtggctatagcaagagggcgctg
atgctgctgcaccccaacataaaggtgatgcgtcacccagaccaagtgacgttgtgggcc
catcatgagaaactcctcgtggtggaccaagtggtagcattcctggggggactggacctt
gcctatggccgctgggatgacctgcactaccgactgactgaccttggagactcctctgaa
tcagctgcctgccagcctcccaccccgtgcccagactcgccagccaccccagacctctct
cacaaccaattcttctggctgggcaaggactacagcaatcttatcaccaaggactgggtg
cagctggaccggcctttcgaagatttcattgacagggagacgacccctcggatgccatgg
cgggacgttggggtggtcgtccatggcctacctgcccgggacctcgcccgacacttcatc
cagcgctggaacttcaccaagaccaccaaggccaagtacaagactcccacatacccctac
ctgcttcccaagtctaccagcacggccaatcagctccccttcacactcccaggaggacag
tgcaccactgtgcaggtcttgcggtcagtggaccgctggtcagcagggactctggagaac
tccatcctcaatgcctacctgcacaccatcagggagagccggcacttcctctacattgag
aatcagttcttcattagttgctcagatgggcggacggttctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggcccacaaacaggggcagtgttatcgagtctacgtgctt
ttgcccttactccctggcttcgaaggtgacatctccacgggcggtggcaactccatccag
gccattctgcactttacttacaggaccctgtgtcgtggggagtattcaatcctgcatcgc
ctcaaagcagccatggggacagcatggcgggactatatttccatctgcgggcttcgtaca
cacggagagctgggtgggcaccctgtctcggagctcatctacatccacagcaagatgctc
atcgcagatgaccggacagtcatcatcggttctgcaaacatcaatgaccggagcttgctg
gggaagcgggacagtgagctggccgtgctgatcgaggacacagagacggaaccatccctc
atgaatggggcagagtatcaggcgggcaggtttgccttgagtctgcggaagcactgcttc
agtgtgattcttggagcaaatacccggctggacttggatctccgagatcccgtctgtgat
ggcttcttccagtggtggcaagacacggctgagagcaacgccaatatctacgagcagatc
ttccgctgcctgccgtccaatgccacgcgttccctgcggacactccgggagtacgtggcc
gtggagcccttggccacagtcagtccccccttggctcggtctgagctcacccaggtccag
ggccacctggtccacttccccctcaagttcctagaggatgagtctttgctgcccccgctg
ggtagcaaggagggcatgatccccctagaagtgtggacatag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100605600
Entry
100605600         CDS       T03265                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00564  Glycerophospholipid metabolism
nle00565  Ether lipid metabolism
nle01100  Metabolic pathways
nle04014  Ras signaling pathway
nle04024  cAMP signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04144  Endocytosis
nle04666  Fc gamma R-mediated phagocytosis
nle04724  Glutamatergic synapse
nle04912  GnRH signaling pathway
nle04928  Parathyroid hormone synthesis, secretion and action
nle05200  Pathways in cancer
nle05212  Pancreatic cancer
nle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100605600 (PLD1)
   00565 Ether lipid metabolism
    100605600 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100605600 (PLD1)
   04072 Phospholipase D signaling pathway
    100605600 (PLD1)
   04071 Sphingolipid signaling pathway
    100605600 (PLD1)
   04024 cAMP signaling pathway
    100605600 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100605600 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100605600 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100605600 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    100605600 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100605600 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100605600 (PLD1)
   05231 Choline metabolism in cancer
    100605600 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100605600 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100605600 (PLD1)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100605600 (PLD1)
Membrane trafficking [BR:nle04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100605600 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    100605600 (PLD1)
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH DUF3785
Other DBs
NCBI-GeneID: 100605600
NCBI-ProteinID: XP_003256509
Ensembl: ENSNLEG00000005457
UniProt: A0A2I3HGH2
LinkDB
Position
11
AA seq 1074 aa
MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVEYDVSPSDPKIQEVYIPFSA
IYNTQGFKEPNIQTYLSGCPIKAQVLDVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRR
KQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAVQENALAKWYVNAKG
YFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNHWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPATTESMESLRLKGKNEPDQNLPIQKS
VDDVDSKLKGIGKPRKFSKFSLYKQLHRHHLYNADSISSIDSSSSYFNHYRSHHNLIHGL
KPHFKLFRPSSESEQGLTRPNADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSMPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSLMDGEEYQAGRFAQGLRLQCF
RVVLGYLDDPGEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
NKPILAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtcactgaaaaacgagccacgggtaaatacctctgcactgcagaaaattgctgcggac
atgagtaatatcatagaaaatctggacacgcgggaactccactttgagggagaggaggta
gaatacgacgtgtctcccagcgatcccaagatacaggaagtgtatatccctttctctgct
atttataacactcaaggatttaaagagcctaatatacagacgtatctctccggctgtcca
ataaaagcacaagttctggacgtggaacgcttcacatctacaacaagggtaccaagtatt
aatctttacactattgaattaacacatggggaatttaaatggcaagttaagaggaaattc
aagcactttcaagaatttcacagagagctgctcaagtacaaagcctttatccgaatcccc
attcccactagaagacacacatttaggaggcaaaacgtcagagaggagcctcgagagatg
cccagtttgccccgttcatctgaaaacatgataagagaagaacaattccttggtagaaga
aaacaactggaagattacttgacaaagatactaaaaatgcccatgtatagaaactatcat
gccacaacagagtttcttgatataagccagctatctttcatacatgatttgggaccaaag
ggcatagaaggtatgataatgaaaagatctggaggacacagaataccaggcttgaattgc
tgtggtcagggaagagcctgctacagatggtcaaaaagatggttaatagtgaaagattcc
tttttattgtatatgaaaccagacagcggtgccattgccttcgtcctgctggtagacaaa
gaattcaaaattaaggtggggaagaaggagacagaaacgaaatatggaatccgaattgat
aatctttcaaggacacttattttaaaatgtaacagctatagacatgctcggtggtgggga
ggggctatagaagaattcatccagaaacatggcaccaactttctcaaagatcatcgattt
gggtcatatgctgctgtccaggagaatgctttagctaaatggtatgttaatgccaaagga
tattttgaagatgtggcaaatgcaatggaagaggcaaatgaagagatttttatcacagat
tggtggctgagtccagaaatcttcctgaaacgcccggtggttgagggaaatcattggagg
ttggactgcattcttaaacgaaaagcacaacaaggagtgaggatcttcataatgctctac
aaagaggtagaacttgctcttggcatcaatagtgaatacaccaagaggactttgatgcgc
ctacatcccaacattaaggtgatgagacacccggatcatgtgtcatccaccgtctatttg
tgggctcaccacgagaagcttgtcatcattgaccaatcggtggcttttgtgggagggatt
gacttggcctatggaaggtgggacgacaatgagcacagactcacagacgtcggcagtgtg
aagcgggtcacttcaggaccatctctgggttccctcccacctgccacaacagagtctatg
gaatccttaagactcaaaggtaaaaatgagcctgatcaaaacctacccatccagaagagt
gttgatgatgtggattcaaaactgaaaggaataggaaagccaagaaagttctccaaattt
agtctctacaagcagctccacaggcaccacctgtacaacgcagatagcatcagcagcatt
gacagcagctccagttattttaatcattatagaagtcatcacaatttaatccatggttta
aaaccccacttcaaactctttcgcccgtccagtgagtctgagcaaggactcactagacct
aatgctgatacggggtccatccgcagtttacagacaggtgtgggagagctgcatggggaa
accagattctggcatggaaaggactactgcaatttcgtcttcaaagactgggttcaactt
gataaaccttttgctgatttcattgacaggtactccatgccccggatgccctggcatgac
attgcctctgcagtccacgggaaggcggctcgtgatgtggcacgtcacttcatccagcgc
tggaacttcacgaaaattatgaaatcaaaatatcggtccctttcttatccttttctgctt
ccaaagtctcaaacaacagcccatgagttgagatatcaagtgcctgggtctgtccacgct
aacgtacagttgctccgctctgctgctgattggtctgctggtataaagtaccatgaagag
tccatccatgctgcttatgtccatgtgatagagaacagcaggcactatatctatattgaa
aaccagtttttcataagctgtgctgatgacaaagttgtgttcaacaagataggcgatgcc
attgcccagaggatcctgaaagctcacagggaaaaccagaaataccgggtatatgtcgtg
ataccgcttctgccagggttcgaaggagacatttcaaccggcggaggaaatgctctacag
gcaatcatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttggacag
ttaaaagcagagcttggtaatcagtggataaattacatatcattctgtggtcttagaaca
catgcagagctcgaaggaaacctagtcactgagcttatctatgtccacagcaagttgtta
attgctgatgataacactgttattattggctctgccaacataaatgaccgcagcatgctg
ggaaagcgtgacagtgaaatggctgtcattgtgcaagatacagagactgttccttcatta
atggatggagaagagtaccaggctggccggtttgcccaaggacttcggctacagtgcttt
agggtggtgcttggctatcttgatgacccaggtgaggacattcaggatccagtgagtgac
aaattcttcaaggaggtgtgggtttcaactgcggctcgaaatgctacaatttatgacaag
gtgttccggtgccttcccaatgatgaagtacacaatttaattcagctgagagactttata
aacaagcccatattagctaaggaagatcccattcgagctgaggaggaactgaagaagatc
cgtggatttttggtgcaattccccttttatttcttgtctgaagaaagcctactgccttct
gttggaaccaaagaggccatagtgcccatggaggtttggacttaa

DBGET integrated database retrieval system