KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100603200
Entry
100603200         CDS       T03265                                 

Gene name
FGF1
Definition
(RefSeq) LOW QUALITY PROTEIN: fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04010  MAPK signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04390  Hippo signaling pathway
nle04810  Regulation of actin cytoskeleton
nle05200  Pathways in cancer
nle05218  Melanoma
nle05224  Breast cancer
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100603200 (FGF1)
   04014 Ras signaling pathway
    100603200 (FGF1)
   04015 Rap1 signaling pathway
    100603200 (FGF1)
   04390 Hippo signaling pathway
    100603200 (FGF1)
   04151 PI3K-Akt signaling pathway
    100603200 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100603200 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100603200 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100603200 (FGF1)
   05218 Melanoma
    100603200 (FGF1)
   05224 Breast cancer
    100603200 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nle04052]
    100603200 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100603200 (FGF1)
Cytokines and growth factors [BR:nle04052]
 Growth factors
  Growth factors (RTK binding)
   100603200 (FGF1)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100603200 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100603200
NCBI-ProteinID: XP_003266602
LinkDB
Position
2
AA seq 214 aa
MPHAATLSPFLQCPPDTGSESGLEGAGISHLLKCWMQPLRFGRSRKLRLESAKSSSCXAM
AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQL
SAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKN
WFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 645 nt   +upstreamnt  +downstreamnt
atgccccatgccgccacattatctccattcctccagtgcccgcctgacactggctctgaa
tcagggctggagggggcaggcatttctcatttactaaagtgctggatgcagcccttgagg
ttcggcagaagcagaaagctgcgtcttgaaagcgccaaaagcagtagctgctgagccatg
gccgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctccaggg
aattacaagaagcccaaactcctctactgtagcaacgggggccacttcttgaggatcctt
ccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcagctc
agtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttggcc
atggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttcctg
gaaaggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaagaat
tggtttgttggcctcaagaagaatggaagctgcaaacgcggtcctcggactcactatggc
cagaaagcaatcttgtttctccccctgccagtctcttctgattaa

DBGET integrated database retrieval system