KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100603734Help
Entry
100603734         CDS       T03265                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle03410  Base excision repair
Module
nle_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:nle00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100603734 (LIG3)
Enzymes [BR:nle01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100603734 (LIG3)
DNA repair and recombination proteins [BR:nle03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     100603734 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N zf-PARP DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme Synaptonemal_3 HD_2
Motif
Other DBs
NCBI-GeneID: 100603734
NCBI-ProteinID: XP_012359067
LinkDB All DBs
Position
Un
AA seq 860 aa AA seqDB search
MAEQRFCVDYAKRGTAGCKKCKEKIVKGICRIGKVVPNPFSEAGGDMKEWYHIKCMFEKL
ERARASTKKIEDLTELEGWEELEDNEKEQITQHIADLSSKAAGTPKKKAIVQAKLTTTGQ
VTSPVKGTSFVTSTNPRKFSGFSAKPNNSAPLSPTPKRSLSSSKCDPRHKDCLLREFRKL
CAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTIYNLNDKQIVKL
FSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTK
EDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQD
VVERVLHNAQEVEKEPGQRRALSVQASLMTPVQPMLAEACKSIEYAMKKCPNGMFSEIKY
DGERVQVHKNGDHFSYFSRSLKPVLPHKVAHFKDYIPQAFPGGHSMILDSEVLLIDNKTG
KPLPFGTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIPNRIM
FSEMKRVTKASDLADMITRVIREGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADT
ADLVVLGAFYGQGSKGGMMSIFLMGCYDPGSQKWCTVTKCAGGHDDATLTRLQKELDMVK
ISKDPSKIPSWLKVNKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTR
IRDDKDWKSATNLPQLKELYQLSKEKADFTVVAGDEGSSTTGGSSEENKGPSGSAVSRKA
PSKPSASTKKAEGELSNSNSKDGNMLTAKPSAMKAGEKLAMKSSPVKVGEKRKAADETLC
QTKRWPASEQRGRTVPAGRR
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaacggttctgtgtggactatgccaagcgtggcacagctggctgcaaaaaa
tgcaaggaaaagattgtgaagggcatatgccgaattggcaaagtggtgcccaatcccttc
tcagaggctgggggtgatatgaaagagtggtaccacattaaatgcatgttcgagaaacta
gagcgggcccgggcctccacaaaaaaaatcgaggacctcacagagctggaaggctgggaa
gagctggaagataatgagaaggaacagataacccagcacattgcagatctgtcttctaag
gcagcaggtacaccaaagaagaaagctattgtccaggctaagttgacaaccactggccag
gtgacttctccagtgaaaggcacctcatttgtcaccagtaccaatccccggaaattttct
ggcttttcagccaagcccaacaactctgcccccttgagccccacccctaagagaagtctg
tcttcaagcaaatgtgaccccaggcataaggactgtctgctacgggagtttcgaaagtta
tgcgccatggtggccgataatcctagctacaacacgaagacccagatcatccaggacttc
ctgcggaaaggctcagcaggagatggtttccacggtgatgtgtacctaacagtgaagctg
ctgctgccaggagtcattaagactatttacaacttgaatgataagcagattgtgaagctt
ttcagtcgcatttttaactgcaacccagatgatatggcacgggacctagagcagggtgac
gtgtcagagacaatcagagtcttctttgagcagagcaagtctttccccccagctgccaag
agcctccttaccatccaggaagtggatgagttccttctgcggctgtccaagctcaccaag
gaggatgagcagcaacaggccctacaggacattgcctccaggtgtacagccaatgacctt
aaatgcatcatcaggttgatcaaacatgatctgaagatgaactcaggtgcaaaacatgtg
ttagacgcccttgaccccaatgcctatgaagccttcaaagcctcgcgcaacctgcaggat
gtggtggagcgagtccttcacaatgcacaggaggtggagaaggagccgggccagagacga
gctctgagcgtccaggcctcactgatgacacctgtgcagcccatgctggcggaggcctgc
aagtccattgagtatgcgatgaagaaatgtcccaatggcatgttctctgagatcaagtac
gatggagagcgagtccaggtgcataagaatggagaccacttcagctacttcagccgcagt
cttaagcccgtcctgcctcacaaggtggcccactttaaggactacattccccaggctttt
cctgggggccacagcatgatcttggattctgaagtgcttctgattgacaacaagacaggc
aaaccactgccctttgggactctgggagtgcacaagaaagcagccttccaggatgctaat
gtctgcctgtttgtttttgattgtatctactttaatgatgtcagcttgatggacaggcct
ctgtgtgagcggcggaagtttcttcatgacaacatggttgaaattccaaaccggataatg
ttctcagaaatgaagcgagtcacaaaagcttcggacttggctgacatgataacccgggtg
atccgggagggattggaggggctggtgctgaaggatgtgaagggtacatatgagcctggg
aagcgacactggctgaaagtgaagaaagactatttgaacgagggggccatggccgacaca
gctgacctggtggtccttggggccttctatgggcaagggagcaaaggcggcatgatgtca
atcttcctcatgggctgctacgaccctggcagccagaagtggtgcacagtcaccaagtgt
gcaggaggccatgatgatgccacgcttacccgcctgcagaaggaactagacatggtgaag
atcagcaaggaccccagcaaaatacccagctggctgaaggtcaacaagatctactatcct
gacttcatcgtcccagacccaaagaaagctgccgtgtgggagatcacaggggctgaattc
tccaaatcggaggctcacacagctgacgggatctccatccgattccctcgctgcacccga
atccgagatgataaggactggaaatctgccactaaccttccccaactcaaggaattgtac
cagttgtccaaggagaaggcagacttcactgtagtggctggagatgaggggagctccact
acagggggtagcagtgaagagaataaggggccctcagggtctgctgtgtcccgcaaggcc
cccagcaagccctcagccagtaccaagaaagcagaaggggagctgagtaactccaacagc
aaagacggcaacatgctgactgcaaagccttctgctatgaaggcgggagagaagctggcc
atgaagtcttctccagtgaaagtaggggagaagcggaaagctgctgatgagaccctgtgc
caaacaaagaggtggccagccagtgagcagagaggaagaactgtgccagcaggcaggaga
tag

DBGET integrated database retrieval system