KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100605325
Entry
100605325         CDS       T03265                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X4
  KO
K05771  glucocorticoid receptor
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100605325 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100605325 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:nle03310]
    100605325 (NR3C1)
Transcription factors [BR:nle03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100605325 (NR3C1)
Nuclear receptors [BR:nle03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100605325 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100605325
NCBI-ProteinID: XP_003266608
Ensembl: ENSNLEG00000009765
LinkDB
Position
2
AA seq 777 aa
MDSKESLTPGREENPSSVLAQERGNVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN
VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASVSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPANKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggactccaaagaatcattaactcctggtagagaagaaaaccccagcagtgtgcttgct
caggagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtgaag
gtttctgcgtcttcaccttcactggctgtcgcttctcagtcagactccaagcagcgaaga
cttttggttgattttccaaaaggctcagtaagcaatgcgcagcagccagatctgtccaaa
gcagtttcactctcaatgggactgtatatgggagagacagaaacaaaagtgatgggaaat
gacctgggattcccacagcagggccaaatcagcctttcctcgggggaaacagacttaaag
cttttggaagaaagcattgcaaacctcaataggtcgaccagtgttccagagaaccccaag
agttcagcatccactgctgtgtctgctgcccccacagagaaggagttcccaaaaactcac
tctgatgtatcttcagaacagcaacatttgaagggccagactggcaccaacggtggcaat
gtgaaattgtataccacagaccaaagcacctttgacattttgcaggatttggagttttct
tctgggtccccaggtaaagagacgaatgagagtccttggagatcagacctgttgatagat
gaaaactgtttgctttctcctctggcgggagaagacgattcattccttttggaaggaaac
tcgaatgaggactgcaagcctctcattttaccggacactaaacccaaaattaaggataat
ggagatctggttttgtcaagccccagtaatgtaacactgccccaagtgaaaacagaaaaa
gaagatttcatcgaactctgcacccctggggtaattaagcaagagaaactgggcacagtt
tactgtcaggcaagctttcctggagcaaatataattggtaataaaatgtctgccatttct
gttcatggtgtgagtacctctggaggacagatgtaccactatgacatgaatacagcatcc
gtttctcaacagcaggatcagaagcctatttttaatgtcattccaccaattcccgttggt
tctgaaaattggaataggtgccaaggatctggagatgacaacttgacttccttggggact
ctgaacttccctggtcgaacagttttttctaatggctattcaagccccagcatgagacca
gatgtaagctctcctccatccagctcctcaacagcaacaacaggaccacctcccaaactc
tgcctggtgtgttctgatgaagcttcaggatgtcattatggagtcttaacttgtggaagc
tgtaaagttttcttcaaaagagcagtggaaggacagcacaattacctatgtgctggaagg
aatgattgcatcatcgataaaattcgaagaaaaaactgcccagcatgccgctatcgaaaa
tgtcttcaggctggaatgaacctggaagctcgaaaaacaaagaagaaaataaaaggaatt
cagcaggccactacaggagtctcacaagaaacctctgaaaatcctgctaacaaaacaata
gttcctgcaacgttaccacaactcacccctaccctggtgtcactgttggaggttattgaa
cctgaagtgttatatgcaggatatgatagttctgttccagactcaacttggaggatcatg
accacactcaacatgttaggagggcggcaagtgattgcagcagtgaaatgggcaaaggca
ataccaggtttcaggaacttacacctggatgaccaaatgaccctactgcagtactcctgg
atgtttcttatggcatttgctctggggtggagatcatatagacaatcaagtgcaaacctg
ctgtgttttgctcctgatctgattattaatgagcagagaatgactctaccctgcatgtac
gaccaatgtaaacacatgctgtatgtttcctctgagttacacaggcttcaggtatcttat
gaagagtatctctgtatgaaaaccttactgcttctctcttcagttcctaaggacggtctg
aagagccaagagctatttgatgaaattagaatgacctacatcaaagagctaggaaaagcc
attgtcaagagggaaggaaactccagccagaactggcagcggttttatcaactgacaaaa
ctcttggattctatgcatgaagtggttgaaaatctccttaactattgcttccaaacattt
ttggataagaccatgagtattgaattcccagagatgttagctgaaatcatcaccaatcag
ataccaaaatattcaaatggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system