KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100605736
Entry
100605736         CDS       T03265                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01522  Endocrine resistance
nle04068  FoxO signaling pathway
nle04110  Cell cycle
nle04115  p53 signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04218  Cellular senescence
nle04310  Wnt signaling pathway
nle04340  Hedgehog signaling pathway
nle04371  Apelin signaling pathway
nle04390  Hippo signaling pathway
nle04510  Focal adhesion
nle04530  Tight junction
nle04630  JAK-STAT signaling pathway
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04934  Cushing syndrome
nle05160  Hepatitis C
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05169  Epstein-Barr virus infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05218  Melanoma
nle05219  Bladder cancer
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100605736 (CCND1)
   04340 Hedgehog signaling pathway
    100605736 (CCND1)
   04390 Hippo signaling pathway
    100605736 (CCND1)
   04371 Apelin signaling pathway
    100605736 (CCND1)
   04630 JAK-STAT signaling pathway
    100605736 (CCND1)
   04068 FoxO signaling pathway
    100605736 (CCND1)
   04151 PI3K-Akt signaling pathway
    100605736 (CCND1)
   04152 AMPK signaling pathway
    100605736 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100605736 (CCND1)
   04115 p53 signaling pathway
    100605736 (CCND1)
   04218 Cellular senescence
    100605736 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100605736 (CCND1)
   04530 Tight junction
    100605736 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100605736 (CCND1)
   04921 Oxytocin signaling pathway
    100605736 (CCND1)
   04919 Thyroid hormone signaling pathway
    100605736 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100605736 (CCND1)
   05206 MicroRNAs in cancer
    100605736 (CCND1)
   05205 Proteoglycans in cancer
    100605736 (CCND1)
   05203 Viral carcinogenesis
    100605736 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100605736 (CCND1)
   05212 Pancreatic cancer
    100605736 (CCND1)
   05225 Hepatocellular carcinoma
    100605736 (CCND1)
   05226 Gastric cancer
    100605736 (CCND1)
   05214 Glioma
    100605736 (CCND1)
   05216 Thyroid cancer
    100605736 (CCND1)
   05221 Acute myeloid leukemia
    100605736 (CCND1)
   05220 Chronic myeloid leukemia
    100605736 (CCND1)
   05218 Melanoma
    100605736 (CCND1)
   05219 Bladder cancer
    100605736 (CCND1)
   05215 Prostate cancer
    100605736 (CCND1)
   05213 Endometrial cancer
    100605736 (CCND1)
   05224 Breast cancer
    100605736 (CCND1)
   05222 Small cell lung cancer
    100605736 (CCND1)
   05223 Non-small cell lung cancer
    100605736 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100605736 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100605736 (CCND1)
   04934 Cushing syndrome
    100605736 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100605736 (CCND1)
   05162 Measles
    100605736 (CCND1)
   05160 Hepatitis C
    100605736 (CCND1)
   05163 Human cytomegalovirus infection
    100605736 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100605736 (CCND1)
   05169 Epstein-Barr virus infection
    100605736 (CCND1)
   05165 Human papillomavirus infection
    100605736 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100605736 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100605736
NCBI-ProteinID: XP_003278068
Ensembl: ENSNLEG00000029930
UniProt: A0A2I3GKV0
LinkDB
Position
4
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEDVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaaatgtgtgcagaaggaggtcctgccgtccatgcggaagatcgtc
gccacctggatgctggaggtctgcgaggagcagaaatgcgaggaggacgtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacttgcatgttcgtggcctctaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacaccgacaactccatccggcccgaggagctgctgcaaatg
gagctgctactggtgaacaagctcaagtggaacctggccgccatgaccccgcacgatttc
attgaacacttcctctccaaaatgccagaggcggaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatccgccc
tccatggtggcagcggggagtgtggtggccgcagtgcaaggcctgaacctgaggagcccc
aacaacttcctgtcctactaccgcctcacacgcttcctctccagagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctgcgc
caggcccagcagaacatggaccccaaggccgccgaggaggaggaagaggaggaggaggag
gtggacctggcttgcacacccaccgacgtgcgggacgtggacatctga

DBGET integrated database retrieval system