KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100605801Help
Entry
100605801         CDS       T03265                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00052  Galactose metabolism
nle00500  Starch and sucrose metabolism
nle01100  Metabolic pathways
nle04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100605801 (MGAM2)
   00500 Starch and sucrose metabolism
    100605801 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100605801 (MGAM2)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100605801 (MGAM2)
    3.2.1.20  alpha-glucosidase
     100605801 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100605801
NCBI-ProteinID: XP_012367599
LinkDB All DBs
Position
13
AA seq 1939 aa AA seqDB search
MARKLRVLEVLLIIFCIIVVAIDILLLLLVLEETSDTSFTPECPEIPQSERIDCTPDQQV
TEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASDGHTNTSTGFTTQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENINLVDGTADASNLSYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDASGSSFGVFLMNSNAMEVTLQPAPAITYRMIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRDYGGINKLKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHDNGQKYLIIMNPGISKNSNYEPYN
NGSLKRVWILGNNGFAVGEGYPGPTVFPDYTNPVCTEWWIDQVAKFHDRLEFDGVWIEMN
EVSSLLQASDNQCESNNLNFPPFLPRVLDHLLFARTLCMDTEFHEGLHYDIHSLYGHSMA
RSTNLALETIFMNNRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGI
PMVGANICGYTNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGANSLLLNSSRH
YLNIRYTLLPYLYTLFYHAHTQGETVARPLVHEFYQDSATWDVHEQFLWGPGLLITPVLY
EGVDEVKAYIPDATWYDYETGVAIPWRKQLVNMLLPGDKIGLHLRGGYIFPTQKPNTTTE
ASRRNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLQAKIINNNY
ADTDNLMFTDITILGMDKQPANFTVLLNNVATSHPSVVYSASTKVVTITDLQGLVLGQEF
SIRWNLPVSDLEKFNCYPDDPTASKESCRQRGCLWEDTSTPGVPTCYYDTIPNYVASDIQ
YLNTSITADLSLLMAPESAAAAASDSFSAKISFLRLNVIYHTATMLQVKIYDPTNKRYEV
PVPLNTPPQPAGDPENHLYDVRIQNNPFGIQIQRKNSSTVIWDSQLPGFTFNDMFLSIST
RLPSQYIYGFGETEHTTFRRNMTWNTWGMFARDEPPAYKKNSYGVHPYYLALEEDGSAHG
VLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPYWAL
GFQLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSANFQNLSLLIEQ
MKKNGMRFILILDPAISGNETQYLPFIRGQENNVFIKWPDTSDIVWGKVWPDLPNVIVDG
SLDHETQVKLYRAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLWIDMNEPS
NFVDGSVRGCSDEMLNNPPYMPYLESRDKGLSSKTLCMESQQILPDSSSVQHYNVHSLYG
WSQTKVTFEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMEFSL
FGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNSTFEMLSR
KVLETRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDHQFMLGPAILISPVL
ETSTFEISAYFPRARWYDYSTEISSKSTGQRKTLKAPLDHINLHVRGGYILPWQEPAMNT
HSSRQNFMGLIVALDDNGKAEGQVFWDDGQSIDTYENGNYFLANFIAAQNILQIQTIHNK
YLSDSNPLKVGYIRIWGVNTYVTQVSFTYDNQQFMETNFKSDPYNQTLTIQLTEKTINLE
KLTEVTWIDGGPVLPTPTKTSTIPMSSHPSPSTNATSSETITSSASANTTTGTTATVPIT
TTSFPTSTTSVTTNTTIPDTTSPFPTSTTNASTNATVPITTTPFIQVLMILFLIILFQLQ
LFLLLQILVLTLLATVFPL
NT seq 5820 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctccgtgtattggaagtccttctgatcatcttctgcataattgtggtg
gccatagacatcctcttgctgcttcttgtgttggaggaaacttcagatacttcatttact
ccagagtgcccagagattccccaatcggaaaggatagactgcacacctgaccagcaggtg
accgaggatatctgcagatggcaatataagtgctgctggtcgcctgtggcagatgccaat
gtccctaggtgcttcttcccctggaactggggctatgaagccagcgatggccatacaaat
acaagcacaggatttactacccagttgaaaaggttgccatcaccatctctgtttggcaat
gatgtcgccaccacccttttcacagctgaatatcagacatccaatcggtttcattttaag
atcactgactttaataacatacgctatgaagtttcccatgaaaatattaacctggttgat
gggactgctgatgcctccaatttgagctattacgtggaggttactgataaacctttcagc
atcaaaataatgaggacaagcaacagaagagtcttgttggacacgagcatcgggcccctc
cagtttgcccagcagtacctgcaactgtctttccgactccccagtgccaatgtgtatggg
ctgggagagcacgtgcaccagcagtaccgccacaatatgacctggaagacctggcccatc
ttcacccgggatgctacccccaccgagggcatgattaatctgtatggagctcataccttc
ttcttgtgccttgaagacgccagtggctcctcttttggagtttttctgatgaacagtaat
gccatggaggttacccttcagccagctcctgcgatcacttatcgcatgattggaggcatt
cttgacttttatgtattcctaggaaacactccagaacaagtggttcaggaatacttggag
cttgttggacggccattcttgcctccctattggagtcttggattccagcttagccgcagg
gattatggtggcatcaataaattgaaagaagttgtcagccgaaatcgtttagctgagata
ccatatgatgtccagtactctgacatagactacatggatggaaagaaagatttcactgtt
gatgaagtcgcttactctggtctcccagattttgtcaaggagttacatgacaatggacag
aaatatcttattattatgaatcccggcatctccaaaaactctaactatgagccctataat
aatggaagcctaaagagagtgtggatcttggggaacaatggctttgctgttggggagggg
tatccgggaccaacagtctttcccgattataccaatccagtatgcactgagtggtggata
gatcaggtcgctaaatttcatgatcgtctggagtttgatggagtgtggattgaaatgaat
gaagtgtctagcttactccaagcttctgataaccagtgtgaatccaacaacttgaacttt
cctccttttctgcctagagttctggatcacttactttttgcgagaactctctgcatggac
acggagtttcatgagggccttcactatgacatccacagcttgtatggccactccatggca
agaagcacaaacttagcgctggagaccatcttcatgaataataggagcttcatcctatcc
cgttctacttttgctggatctggcaaatttgctgctcattggctgggggacaatgcggcc
acatgggatgacctccgatggtctatccccactatccttgagttcaacctgtttggcatc
cccatggtaggtgccaacatctgtggttataccaacaatgtcacagaggagctctgcaga
aggtggatgcagcttggagcattttatccactaccaaggaatcacaatgggcctgggttc
agggaccaggatcctgctgcctttggtgccaattccctgctgctgaattcctccagacat
tatctgaacatccgctacaccttgctgccctatctctatacccttttctaccatgctcac
acccagggagagacggtagcaaggccccttgtacacgagttctaccaggactcagccacg
tgggatgtgcatgagcagttcttatggggacctggactcctcatcacgcctgttttatat
gaaggtgtggatgaagtgaaagcatacatacctgatgccacctggtatgactatgagaca
ggagtggccatcccatggaggaaacagttggtgaatatgcttctcccaggtgataagata
ggacttcatctgcgagggggctacatatttcccactcagaagccaaacacaaccacagaa
gccagccggaggaattccctgggactcatcatcgctttggactataagagagaagcaaag
ggggagctgtactgggatgacggtgtatctaaagatgctgtaactgaaaagaagtatatt
ctatatgatttctctgttacctctaaccatctacaagcaaagattataaataataattat
gcggacactgacaacctcatgtttacagatatcacaatcttgggaatggacaaacagcca
gctaattttaccgtcttactgaataatgtcgccacctcccatccaagcgttgtctacagt
gcttccacaaaggtggtaaccatcactgatctgcaaggactggtactgggacaagaattc
tctattaggtggaatcttcctgtcagtgacctggagaagttcaactgctaccctgatgat
ccaacagcctctaaggagagttgtaggcagcgggggtgtctttgggaggacacatctacc
cctggagtgcccacctgttactatgacaccatccctaattatgttgctagtgacattcag
tacctgaacaccagcatcactgcagacctttccctcctgatggcccctgagtcagctgct
gctgccgcctctgattctttctctgcaaagatcagcttcctccgcctgaacgtgatctat
cacacagcaaccatgctgcaggtcaagatctatgaccccactaataaaaggtatgaggtt
ccagtaccactgaacacccctccccaaccagctggtgaccctgaaaaccatctgtatgat
gtcaggattcagaacaatccttttggaatccagattcaacgcaaaaactccagcactgtg
atttgggattctcaactccctggcttcaccttcaatgacatgtttctctccatttctaca
cgtctgccgtctcagtacatctatggctttggggaaactgagcacacgactttcagaaga
aacatgacctggaacacatggggaatgtttgctcgtgatgagccacctgcgtacaagaag
aattcctatggtgtccacccttactacctggcactggaggaggatggtagtgcccatgga
gtgctcctgctaaatagcaatgccatggatgtgacattacagcccactcctgccctgaca
taccgcaccacaggagggattttggacttctacattgttttggggccaacccctgaactt
gtaactcagcaatacacagagttgatcggtcggccagcaatgattccatactgggccttg
ggattccagctgagtcgctatggataccagaatgatgctgaaatctccagtttgtatgat
gcaatggtggcagcccagattccctatgacgtccagcatgtagacattgattacatgaac
cggaagctggatttcaccctcagtgccaactttcaaaacctcagtcttctgattgagcaa
atgaagaaaaatggcatgagatttattctcattttggacccagccatttctggcaatgag
acacagtatctcccattcattagaggacaggaaaataacgtgttcatcaaatggcctgac
accagtgacattgtctggggaaaggtttggccagacctgcctaacgtaattgtagatgga
tcccttgaccatgaaactcaggttaagctttacagggcctacgttgcctttcctgacttc
tttcgtaatagcacagctgcgtggtggaagaaagaaatagaagagctctatgcaaatcct
cgagagccagagaagagcttgaagtttgatggattgtggattgatatgaatgagccatca
aattttgtggatggatctgtcaggggctgcagcgatgaaatgctaaataacccaccctat
atgccatatttggaatctagggacaagggcctgagcagcaagactctgtgcatggagagt
cagcagatcctgccggacagctcctccgtgcagcactacaatgttcacagcctgtacggg
tggtcccagaccaaagtaacgtttgaagctgtgcaggaggtgacaggacagcgaggggtc
gtcatcacccgctccacatttccctcttctggacgctggggaggacactggctgggagac
aacacagctgcgtgggaccagctggggaaatctatcattggcatgatggagttcagtctg
tttggaataccttatacaggagcagatatctgtgggttctttggagatgctgaatatgag
atgtgtgttcgctggatgcaactgggggcattttatccattttccagaaaccacaacaac
attgggacaaggagacaagatcctgtggcctggaattcaacctttgagatgttgtccaga
aaagtcctagagaccagatacaccctgcttccttatctctatactctgatgcataaagct
cacgttgagggcagcaccgttgtccggccccttctccatgagtttacggatgacaggaca
acatgggacatagaccatcagttcatgttgggccctgctatcttaatcagccctgtgttg
gaaactagcacatttgagatctccgcttattttccgagagcccgttggtatgactatagc
acggaaattagcagcaaatcgacaggtcagaggaaaaccctgaaggctccccttgaccac
atcaatcttcatgtcagaggaggctacatcctgccctggcaggagcctgcaatgaacact
cactccagtcgacaaaattttatgggattgattgttgctttggatgacaatgggaaagct
gaaggccaggtgttctgggatgatggacaaagcattgatacctatgaaaatggaaattat
tttttggcaaactttatagcagctcagaacatcctgcaaatccagaccatacacaataag
tatttgagtgactcgaatccactaaaagttgggtatattagaatctggggtgtgaatacc
tatgtgacacaagtcagtttcacctatgacaaccagcaatttatggagacaaatttcaag
agtgacccttataatcagacactaactattcaattgactgagaagactatcaacctggaa
aagttaactgaggttacttggattgatggtggtcctgtacttcctactccaactaagaca
agtaccatcccaatgagttctcatccttctccatctaccaatgccaccagttctgagaca
atcaccagttctgccagtgcaaatactaccactggcactactgctactgttcctatcaca
accacatctttcccaacaagtactactagtgttacaactaatactactattcctgataca
acttctcctttccctacaagtactactaatgctagcactaatgctactgttcctatcaca
accacacctttcatacaagtactgatgatactgtttctaataatactgttccaattacag
ctattccttctcttgcaaatactggtgttgacactactagcaacagtttttccattatga

DBGET integrated database retrieval system