KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100606456Help
Entry
100606456         CDS       T03265                                 

Gene name
PCSK2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nle01002]
    100606456 (PCSK2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nle03110]
    100606456 (PCSK2)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     100606456 (PCSK2)
Peptidases [BR:nle01002]
 Serine Peptidases
  Family S8: subtilisin family
   100606456 (PCSK2)
Chaperones and folding catalysts [BR:nle03110]
 Intramolecular chaperones
  Subtilisin family
   100606456 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 100606456
NCBI-ProteinID: XP_003268251
UniProt: G1REW0
LinkDB All DBs
Position
13
AA seq 638 aa AA seqDB search
MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDAARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWRTVPERFHCVGGSAQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAQQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILNKN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtggttgtgtctcccagtggaaggcggccgctgggttcctcttctgtgtcatg
gtttttgcatctgctgagcgaccggtcttcacgaatcattttcttgtggagttgcataaa
gggggagaggacgcagctcgccaagttgcagcagaacacggctttggagtccgaaagctt
ccctttgctgaaggtctgtaccacttttatcacaatggccttgcaaaggccaagagaaga
cgcagcctacaccacaagcagcagctggagagagaccccagggtaaagatggctttgcag
caggaaggatttgaccgaaaaaagcgaggttacagagacatcaatgagattgacatcaac
atgaacgatcctctttttacaaagcaatggtatctgatcaatactgggcaagctgatggc
actcctggccttgatttgaatgtggctgaagcctgggagctgggatacacagggaaaggt
gttaccattggaattatggatgatgggattgactatctccacccggacctggcctccaac
tacaatgccgaagcaagttacgacttcagcagcaacgacccttatccttaccctcggtac
acagatgactggtttaacagccatgggacccgatgtgcaggagaagtttctgctgccgcc
aacaacaatatctgtggagttggagtagcatacaactccaaggtagcaggcatccggatg
ctggaccagccattcatgacggacatcatcgaggcctcctccatcagccatatgccgcag
ctgatcgacatctacagcgccagctggggccccacagacaacggcaagacagtggatggg
ccccgggagctcacgctgcaggccatggccgatggcgtgaacaagggccgcggcggcaaa
ggcagcatctacgtgtgggcctccggggacggcggcagctatgacgactgcaactgcgac
ggctacgcctccagcatgtggaccatctccattaactcagccatcaacgatggcaggacc
gccctgtacgacgagagctgctcttccaccctggcttccaccttcagcaacgggaggaaa
aggaaccccgaggccggtgtggcaaccacagatttgtatggcaactgcactctgaggcat
tctgggacatctgcagctgcccccgaagcagctggcgtgtttgcactggctctggaggct
aacctgggtctgacctggcgggacatgcagcatctgactgtgctcacctccaaacggaac
cagcttcacgacgaggtccatcagtggcggcgcaacggggtcggcctggaatttaatcac
ctctttggctacggggtccttgatgcaggcgccatggtgaaaatggctaaagactggaga
accgtgcctgagagattccactgtgtgggaggctccgcgcaggaccctgagaaaatacca
tccactggcaagttggtgctgacactcacaaccgacgcctgtgaggggaaggaaaatttt
gtccgctacctggagcatgtccaggctgtcatcacggtcaacgcaaccaggagaggagat
ctgaacatcaacatgacttcccctatgggcaccaagtccattttgctgagccggcgtcca
agggatgacgactccaaggtgggctttgacaagtggcctttcatgaccactcacacgtgg
ggggaagacgcccgaggcacctggaccctggagctgggatttgtcggcagcgcccagcag
aagggggtgctgaaggagtggaccctgatgctgcatggcactcagagcgccccgtacatc
gaccaagtggtgcgggattaccagtccaagctggccatgtccaagaaagaggagctggag
gaagagctggatgaagccgtggagagaagcctgaaaagcatccttaacaagaactag

DBGET integrated database retrieval system