KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100606849
Entry
100606849         CDS       T03265                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04010  MAPK signaling pathway
nle04060  Cytokine-cytokine receptor interaction
nle04068  FoxO signaling pathway
nle04144  Endocytosis
nle04218  Cellular senescence
nle04350  TGF-beta signaling pathway
nle04380  Osteoclast differentiation
nle04390  Hippo signaling pathway
nle04520  Adherens junction
nle04659  Th17 cell differentiation
nle04926  Relaxin signaling pathway
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle05142  Chagas disease
nle05161  Hepatitis B
nle05166  Human T-cell leukemia virus 1 infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05210  Colorectal cancer
nle05212  Pancreatic cancer
nle05220  Chronic myeloid leukemia
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100606849 (TGFBR2)
   04350 TGF-beta signaling pathway
    100606849 (TGFBR2)
   04390 Hippo signaling pathway
    100606849 (TGFBR2)
   04068 FoxO signaling pathway
    100606849 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100606849 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100606849 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    100606849 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100606849 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100606849 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100606849 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100606849 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100606849 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    100606849 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100606849 (TGFBR2)
   05212 Pancreatic cancer
    100606849 (TGFBR2)
   05225 Hepatocellular carcinoma
    100606849 (TGFBR2)
   05226 Gastric cancer
    100606849 (TGFBR2)
   05220 Chronic myeloid leukemia
    100606849 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100606849 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100606849 (TGFBR2)
   05161 Hepatitis B
    100606849 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100606849 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100606849 (TGFBR2)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100606849 (TGFBR2)
Protein kinases [BR:nle01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100606849 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100606849
NCBI-ProteinID: XP_003256849
Ensembl: ENSNLEG00000004162
UniProt: A0A2I3H3F9
LinkDB
Position
4
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMMVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSSWETGKTRKLMEFSDHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggttaataatgacatgatggtcactgac
aacaatggtgcagtcaagtttccacaactgtgtaaattttgtgatgtgagattttccacc
tgtgacaaccagaaatcctgcatgagcaactgcagcatcacctccatctgtgagaagcca
caggaagtctgtgtggctgtatggagaaagaatgacgagaacataacactagagacagtt
tgccatgaccccaagctcccctaccacgactttattctggaagatgctgcttctccaaag
tgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatgtgttcctgtagctct
gatgagtgcaatgacaacatcatcttctcagaagaatataacaccagcaatcctgacttg
ttgctagtcatatttcaagtgacaggcatcagccttctgccaccactgggagttgccata
tctgtcatcatcatcttctactgctaccgtgttaaccggcagcagaagctgagttcatcc
tgggaaaccggcaagacacggaagctcatggagttcagcgatcactgtgccatcatcctg
gaagacgaccgctctgacatcagctccacgtgcgccaacaatatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtagggaaaggtcgctttgctgaggtctataag
gccaagctgaagcagaacacttcagagcagtttgagacagtggcagtcaaaatctttccc
tatgaggagtatgcatcttggaagacggagaaggacatcttctcagacatcaacctgaag
catgagaacatactccagttcctgacggctgaggagcggaagacggagttggggaaacag
tactggctgatcactgccttccacgccaagggcaacctacaggagtacctgacgcggcat
gtcatcagctgggaggacctgcgcaagctgggcagctccctcgcccggggcattgctcac
ctccatagtgatcacactccatgcgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtgaagaatgacctaacctgctgcctttgtgactttgggctt
tccctgcgtctggaccctactctgtctgtggatgacctggctaacagcgggcaggtggga
actgcaagatacatggctccagaagtcctagaatccaggatgaatttggagaatgttgag
tccttcaagcagaccgatgtctactccatggctctagtgctctgggaaatgacatctcgc
tgtaatgcagtgggagaagtaaaagattatgagcctccatttggttccaaggtgcgggag
cacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgagggcgaccagaaatt
cccagcttctggctcaaccaccagggcatccagatggtgtgtgagacattgactgagtgc
tgggaccacgacccagaggcccgtctcacagcccagtgtgtggcagaacgcttcagtgag
ctggagcacctggacaggctctcggggaggagctgctcggaggagaagattcctgaagac
ggctccctaaacactaccaaatag

DBGET integrated database retrieval system