KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100606885
Entry
100606885         CDS       T03265                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle04012  ErbB signaling pathway
nle04062  Chemokine signaling pathway
nle04110  Cell cycle
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04310  Wnt signaling pathway
nle04340  Hedgehog signaling pathway
nle04360  Axon guidance
nle04390  Hippo signaling pathway
nle04510  Focal adhesion
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04657  IL-17 signaling pathway
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04722  Neurotrophin signaling pathway
nle04728  Dopaminergic synapse
nle04910  Insulin signaling pathway
nle04916  Melanogenesis
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease
nle04934  Cushing syndrome
nle04935  Growth hormone synthesis, secretion and action
nle05010  Alzheimer disease
nle05020  Prion disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05135  Yersinia infection
nle05160  Hepatitis C
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05200  Pathways in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05215  Prostate cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100606885 (GSK3B)
   04310 Wnt signaling pathway
    100606885 (GSK3B)
   04340 Hedgehog signaling pathway
    100606885 (GSK3B)
   04390 Hippo signaling pathway
    100606885 (GSK3B)
   04151 PI3K-Akt signaling pathway
    100606885 (GSK3B)
   04150 mTOR signaling pathway
    100606885 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100606885 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100606885 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    100606885 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100606885 (GSK3B)
   04657 IL-17 signaling pathway
    100606885 (GSK3B)
   04662 B cell receptor signaling pathway
    100606885 (GSK3B)
   04062 Chemokine signaling pathway
    100606885 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100606885 (GSK3B)
   04917 Prolactin signaling pathway
    100606885 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    100606885 (GSK3B)
   04919 Thyroid hormone signaling pathway
    100606885 (GSK3B)
   04916 Melanogenesis
    100606885 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100606885 (GSK3B)
   04722 Neurotrophin signaling pathway
    100606885 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    100606885 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100606885 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100606885 (GSK3B)
   05225 Hepatocellular carcinoma
    100606885 (GSK3B)
   05226 Gastric cancer
    100606885 (GSK3B)
   05217 Basal cell carcinoma
    100606885 (GSK3B)
   05215 Prostate cancer
    100606885 (GSK3B)
   05213 Endometrial cancer
    100606885 (GSK3B)
   05224 Breast cancer
    100606885 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100606885 (GSK3B)
   05020 Prion disease
    100606885 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    100606885 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100606885 (GSK3B)
   04931 Insulin resistance
    100606885 (GSK3B)
   04934 Cushing syndrome
    100606885 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100606885 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100606885 (GSK3B)
   05162 Measles
    100606885 (GSK3B)
   05163 Human cytomegalovirus infection
    100606885 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100606885 (GSK3B)
   05165 Human papillomavirus infection
    100606885 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100606885 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100606885 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100606885 (GSK3B)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100606885 (GSK3B)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   100606885 (GSK3B)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100606885 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 100606885
NCBI-ProteinID: XP_003261918
Ensembl: ENSNLEG00000005074
UniProt: G1QYY9
LinkDB
Position
21
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcgacccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggacggcagcaaggtgacaacagta
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggtcgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactccagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatttatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccgcagaacctcttgttggatcctgatacagccgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgctggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggat
agtggtgtggatcagttggtagaaataatcaaggtcctgggaactccaacaagagagcaa
atcagagaaatgaacccaaactacacagaatttaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cgaactccaccggaggcaattgcactgtgtagccgtctgctggagtatacgccaactgcc
cgactaacaccactggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctggctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaacccccacaaatgccacagcagcctcagatgctaatactggagaccgtggacag
accaataatgctgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system