KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100607291
Entry
100607291         CDS       T03265                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04022  cGMP-PKG signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04144  Endocytosis
nle04150  mTOR signaling pathway
nle04270  Vascular smooth muscle contraction
nle04310  Wnt signaling pathway
nle04350  TGF-beta signaling pathway
nle04360  Axon guidance
nle04510  Focal adhesion
nle04520  Adherens junction
nle04530  Tight junction
nle04611  Platelet activation
nle04621  NOD-like receptor signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04660  T cell receptor signaling pathway
nle04670  Leukocyte transendothelial migration
nle04722  Neurotrophin signaling pathway
nle04810  Regulation of actin cytoskeleton
nle04921  Oxytocin signaling pathway
nle04928  Parathyroid hormone synthesis, secretion and action
nle04972  Pancreatic secretion
nle05100  Bacterial invasion of epithelial cells
nle05132  Salmonella infection
nle05133  Pertussis
nle05135  Yersinia infection
nle05152  Tuberculosis
nle05163  Human cytomegalovirus infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100607291 (RHOA)
   04015 Rap1 signaling pathway
    100607291 (RHOA)
   04310 Wnt signaling pathway
    100607291 (RHOA)
   04350 TGF-beta signaling pathway
    100607291 (RHOA)
   04072 Phospholipase D signaling pathway
    100607291 (RHOA)
   04071 Sphingolipid signaling pathway
    100607291 (RHOA)
   04024 cAMP signaling pathway
    100607291 (RHOA)
   04022 cGMP-PKG signaling pathway
    100607291 (RHOA)
   04150 mTOR signaling pathway
    100607291 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100607291 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100607291 (RHOA)
   04520 Adherens junction
    100607291 (RHOA)
   04530 Tight junction
    100607291 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100607291 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100607291 (RHOA)
   04621 NOD-like receptor signaling pathway
    100607291 (RHOA)
   04625 C-type lectin receptor signaling pathway
    100607291 (RHOA)
   04660 T cell receptor signaling pathway
    100607291 (RHOA)
   04670 Leukocyte transendothelial migration
    100607291 (RHOA)
   04062 Chemokine signaling pathway
    100607291 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100607291 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    100607291 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100607291 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    100607291 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100607291 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    100607291 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100607291 (RHOA)
   05206 MicroRNAs in cancer
    100607291 (RHOA)
   05205 Proteoglycans in cancer
    100607291 (RHOA)
   05203 Viral carcinogenesis
    100607291 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100607291 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100607291 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100607291 (RHOA)
   05135 Yersinia infection
    100607291 (RHOA)
   05133 Pertussis
    100607291 (RHOA)
   05152 Tuberculosis
    100607291 (RHOA)
   05100 Bacterial invasion of epithelial cells
    100607291 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100607291 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100607291 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100607291 (RHOA)
   04031 GTP-binding proteins [BR:nle04031]
    100607291 (RHOA)
Membrane trafficking [BR:nle04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100607291 (RHOA)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100607291 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   100607291 (RHOA)
  Exosomal proteins of colorectal cancer cells
   100607291 (RHOA)
  Exosomal proteins of bladder cancer cells
   100607291 (RHOA)
GTP-binding proteins [BR:nle04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100607291 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 100607291
NCBI-ProteinID: XP_030667636
Ensembl: ENSNLEG00000006839
LinkDB
Position
4
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggtgcctgtggaaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag
aactatgtggcagatatcgaggtggatggaaagcaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata
ctgatgtgtttttccatcgacagtcctgatagtttagaaaacatcccagaaaagtggacc
ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa
gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system