KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100607433
Entry
100607433         CDS       T03265                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04060  Cytokine-cytokine receptor interaction
nle04066  HIF-1 signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04630  JAK-STAT signaling pathway
nle04640  Hematopoietic cell lineage
nle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100607433 (EPO)
   04066 HIF-1 signaling pathway
    100607433 (EPO)
   04151 PI3K-Akt signaling pathway
    100607433 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100607433 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100607433 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100607433 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nle04052]
    100607433 (EPO)
Cytokines and growth factors [BR:nle04052]
 Cytokines
  CSF and other factors
   100607433 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100607433
NCBI-ProteinID: XP_003278152
Ensembl: ENSNLEG00000011941
UniProt: G1RMP4
LinkDB
Position
17
AA seq 193 aa
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENVTTGCAEHC
SLSENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLANSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKETISPPDAASAAPLRTITADTFCKLFRVYSNFLRGKL
KLYTGEACRRGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttcttctgtccctgctgtctctccct
ctgggcctcccagtcctgggcgccccaccacgccttatctgtgacagccgagtcctggag
aggtacctcttggaggcaaaggaggccgagaatgtcacgacaggctgtgccgaacactgc
agcttgagtgagaatatcaccgtcccagacaccaaagttaacttctatgcctggaagagg
atggaggttgggcagcaggccgtagaagtctggcagggcctggccctgctctcggaagct
gtcctgcggggccaggccctgttggccaactcttcccagccatgggagcccctgcagcta
cacgtggataaagccgtcagtggccttcgcagcctcaccactctgcttcgggcgctggga
gcccagaaggaaaccatctcccctccagatgcggcctcggctgctccactccgaacaatc
actgctgacactttctgcaaactcttccgagtctactccaatttcctccggggaaagctg
aagctgtacacaggggaggcctgcaggagaggggacagatga

DBGET integrated database retrieval system