KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100607585
Entry
100607585         CDS       T03265                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X3
  KO
K08774  transforming growth factor, alpha
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04915  Estrogen signaling pathway
nle05200  Pathways in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05223  Non-small cell lung cancer
nle05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100607585 (TGFA)
   04012 ErbB signaling pathway
    100607585 (TGFA)
   04014 Ras signaling pathway
    100607585 (TGFA)
   04151 PI3K-Akt signaling pathway
    100607585 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100607585 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100607585 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100607585 (TGFA)
   05212 Pancreatic cancer
    100607585 (TGFA)
   05225 Hepatocellular carcinoma
    100607585 (TGFA)
   05214 Glioma
    100607585 (TGFA)
   05211 Renal cell carcinoma
    100607585 (TGFA)
   05215 Prostate cancer
    100607585 (TGFA)
   05223 Non-small cell lung cancer
    100607585 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100607585 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 100607585
NCBI-ProteinID: XP_003262568
Ensembl: ENSNLEG00000010189
LinkDB
Position
14
AA seq 160 aa
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccctgttcgcgctgggtattgtgttggccgcgtgc
caggccttggagaacagcacgtccccgctgagcgcagacccgcccgtggccgcagcagtg
gtgtcccattttaatgactgcccagattcccacactcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggtgca
cgctgtgagcatgcagacctcctggccgtggtggccgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtccttatcatcacatgtgtgctg
atacactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcac
gagaagcccagcgccctcctgaagggaagaaccgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system