KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 101177222Help
Entry
101177222         CDS       T03265                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00500  Starch and sucrose metabolism
nle01100  Metabolic pathways
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04910  Insulin signaling pathway
nle04922  Glucagon signaling pathway
nle04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101177222 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101177222 (GYS2)
   04152 AMPK signaling pathway
    101177222 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101177222 (GYS2)
   04922 Glucagon signaling pathway
    101177222 (GYS2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    101177222 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nle01003]
    101177222 (GYS2)
Enzymes [BR:nle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101177222 (GYS2)
Glycosyltransferases [BR:nle01003]
 Polysaccharide
  Storage polysaccharide
   101177222 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 101177222
NCBI-ProteinID: XP_012357719
LinkDB All DBs
Position
23
AA seq 681 aa AA seqDB search
MLRGRSLSVTSLSGLPRWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
DNYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVVAQFH
EWQAGIGLILSRTRKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDVAHSVKEKFGKKLYDALLRGEIPDMNNIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHVEPASPPTTEGFKYPRPSSVPPSPSGSQSSSPQSSDVE
SPFSLSHVPHGKKKLHGEYKN
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggccgatccctgtcggtaacatccctgagtgggcttccccggtgggaagtc
gaagaacttcctgtggaagagttactgctctttgaagttgcttgggaagtgaccaataaa
gttggaggcatctatactgtgattcagacaaaggccaaaacaacagcagatgaatgggga
gacaactattttctgataggtccatattttgagcataatatgaagactcaggtggaacag
tgtgaacctgtaaatgatgctgtcagaagagcagtggacgcaatgaataagcatggctgc
caggtgcattttggaagatggctgatagaaggaagtccttatgtggtactttttgacata
ggctactcagcttggaatctggacaggtggaagggtgacctctgggaagcatgcagtgtc
ggcattccttatcatgaccgagaagccaatgatatgctgatatttggatctttaactgcc
tggttcttaaaagaggtgacagatcatgcagatggtaaacatgtcgttgcccaattccat
gaatggcaggctggaattggactgatcctttctcgaacaaggaaacttcctattgccaca
atatttacaacccacgctacactacttgggaggtatctctgtgcagcaaatattgatttc
tacaaccatcttgataagtttaacattgacaaagaggctggggaaaggcagatttaccac
cggtactgcatggagcgagcttccgttcattgcgctcacgtgttcaccacggtttctgaa
ataacagcaatagaggctgaacatatgctgaagagaaagcctgatgtagttactccaaat
ggcttgaatgttaagaaattttcagcagtgcatgagtttcaaaatctacatgccatgtac
aaggccagaatccaagattttgttcgaggtcatttctatggtcatctcgactttgatctt
gaaaagactttgttccttttcattgctgggaggtacgagttttcaaacaaaggagctgac
atcttcctagaatccttatctaggctaaatttcctgctgaggatgcataaaagtgacgtc
actgtggtggtgtttttcattatgcctgccaagacaaataatttcaacgtggaaaccctg
aaaggacaagcagtgcgaaaacagctgtgggatgttgcgcattctgtgaaggaaaagttt
ggcaaaaaactctatgatgcattgttaagaggagaaattcctgacatgaacaatatttta
gatcgagatgatctaacaattatgaaaagagccatcttttcaactcagcgacagtcattg
cccccagtgaccacgcacaacatgattgatgactccaccgaccccatcctcagcaccatt
agacggattggacttttcaacaaccgcacagatagagtcaaggtgattttgcacccagag
tttctatcctccaccagtcccttactacccatggactatgaagagtttgttagaggttgt
catcttggagtatttccatcatactatgaaccctggggttatactccagctgaatgcact
gtgatgggtatccccagtgtgaccacgaatctctccgggtttggctgtttcatgcaagag
cacgtggctgatcctactgcttacggtatttacatcgttgacaggcggttccgttctcca
gatgattcttgcaatcagctgactaagtttctctatggattttgcaaacagtcacgccgc
caaaggattatccagaggaacagaactgagaggctctcagatcttctggattggagatac
ttaggcagatattaccagcatgccaggcacctgacattaagcagagcttttccagataaa
ttccatgtggaaccagcatcaccaccaacgacagaaggatttaaatatcccaggccttcc
tcagtaccaccttctccttcagggtctcagtcctccagtcctcagagcagtgatgtggaa
tcaccattttcactgagccacgttcctcatgggaagaaaaagctgcatggtgaatataag
aactga

DBGET integrated database retrieval system