KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 101178725
Entry
101178725         CDS       T03265                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04022  cGMP-PKG signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04140  Autophagy - animal
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04370  VEGF signaling pathway
nle04510  Focal adhesion
nle04722  Neurotrophin signaling pathway
nle04910  Insulin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle05010  Alzheimer disease
nle05014  Amyotrophic lateral sclerosis
nle05020  Prion disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05145  Toxoplasmosis
nle05152  Tuberculosis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05165  Human papillomavirus infection
nle05168  Herpes simplex virus 1 infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05215  Prostate cancer
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05223  Non-small cell lung cancer
nle05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101178725 (BAD)
   04014 Ras signaling pathway
    101178725 (BAD)
   04370 VEGF signaling pathway
    101178725 (BAD)
   04024 cAMP signaling pathway
    101178725 (BAD)
   04022 cGMP-PKG signaling pathway
    101178725 (BAD)
   04151 PI3K-Akt signaling pathway
    101178725 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101178725 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    101178725 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101178725 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101178725 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101178725 (BAD)
   04919 Thyroid hormone signaling pathway
    101178725 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101178725 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101178725 (BAD)
   05203 Viral carcinogenesis
    101178725 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101178725 (BAD)
   05212 Pancreatic cancer
    101178725 (BAD)
   05225 Hepatocellular carcinoma
    101178725 (BAD)
   05221 Acute myeloid leukemia
    101178725 (BAD)
   05220 Chronic myeloid leukemia
    101178725 (BAD)
   05218 Melanoma
    101178725 (BAD)
   05211 Renal cell carcinoma
    101178725 (BAD)
   05215 Prostate cancer
    101178725 (BAD)
   05213 Endometrial cancer
    101178725 (BAD)
   05223 Non-small cell lung cancer
    101178725 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101178725 (BAD)
   05014 Amyotrophic lateral sclerosis
    101178725 (BAD)
   05020 Prion disease
    101178725 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    101178725 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101178725 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101178725 (BAD)
   05161 Hepatitis B
    101178725 (BAD)
   05160 Hepatitis C
    101178725 (BAD)
   05162 Measles
    101178725 (BAD)
   05168 Herpes simplex virus 1 infection
    101178725 (BAD)
   05165 Human papillomavirus infection
    101178725 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101178725 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101178725 (BAD)
   01524 Platinum drug resistance
    101178725 (BAD)
   01522 Endocrine resistance
    101178725 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 101178725
NCBI-ProteinID: XP_030666923
Ensembl: ENSNLEG00000028113
LinkDB
Position
4
AA seq 168 aa
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSGSGKHHRQAPGLLWDASHQQEQLTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagccgagtgagcaggaagactccagctctgcagagagg
ggcctgggccccagccccgcaggggacaggccctcaggctctggcaagcatcatcgccag
gccccaggcctcctgtgggacgccagtcaccagcaggagcagctaaccagcagcagccat
catggaggcgctggggctgtggagatccggagtcgccacagctcctaccccgcggggacg
gaagacgacgaagggatgggggaggagcccagcccttttcgcggccgctcgcgctcggcg
ccccccaacctctgggcagcacagcgctatggccgcgagctccggaggatgagtgacgag
tttgtggactcctttaagaagggacttcctcgcccgaagagcgcgggcacagcaacgcag
atgcggcaaagctccagctggacgcgagtcttccagtcctggtgggatcggaacttgggc
aggggaagctccgccccctcccagtga

DBGET integrated database retrieval system