KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 105740366Help
Entry
105740366         CDS       T03265                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle03030  DNA replication
nle03410  Base excision repair
nle03420  Nucleotide excision repair
nle03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nle00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105740366 (LIG1)
   03410 Base excision repair
    105740366 (LIG1)
   03420 Nucleotide excision repair
    105740366 (LIG1)
   03430 Mismatch repair
    105740366 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nle03032]
    105740366 (LIG1)
   03400 DNA repair and recombination proteins [BR:nle03400]
    105740366 (LIG1)
Enzymes [BR:nle01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105740366 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     105740366 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105740366 (LIG1)
DNA replication proteins [BR:nle03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105740366 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105740366 (LIG1)
DNA repair and recombination proteins [BR:nle03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105740366 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     105740366 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     105740366 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR
Motif
Other DBs
NCBI-GeneID: 105740366
NCBI-ProteinID: XP_012365260
LinkDB All DBs
Position
10
AA seq 852 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPAPDCSQVSPPRPATCPENNASLSDTSPTDSSPSGIPK
RRTEAETPTESVSEPEVATKQELQEEEEQTKPPRRAPKTLSSFFTPWKPAIKKEVKEEEP
GAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIEEVSARLRM
VETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQATGRQLES
VRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSASTAKKIDIIK
GLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAVVDAGKGKT
AEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLDCLPEHCKLSPGIPLKPMLAHPT
RGVSEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPDIISRIPKI
KLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGE
SLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVEQIAEFLEQSVKDSCEGLMVKTLD
VDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSE
ELQAICKLGTGFSDEELEEHXXSLQALVLPSPRPYVRIDGAVTPDHWLDPSAVWEVKCAD
LSLSPIYPAARGLXVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQ
GEDSGSDPEDTY
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccaccccaagaaagagggtaaagcgaagaagcct
gagaaggaggcatccaacagcagcagagagacagagccccctccaaaggcggcactgaag
gagtggaatggagtggtgtccgagagtgactctccagtgaagaggccagggaggaaggcg
gcccgggtcctgggcagtgaaggggaggaggaggatgaagcccttagccctgctaaaggc
cagaagcctgccccggactgctcacaggtctccccgccccgtcctgccacatgtcctgaa
aacaatgcttccctctctgacacctctcccacggacagttccccatcagggatcccgaag
cgtcgcacagaagcagagaccccgacggaaagcgtttcagagcctgaggtggccacgaag
caggaactgcaggaggaggaggagcagaccaagcctccccgcagagctcccaagacgctc
agcagcttcttcaccccctggaagccagcaatcaaaaaagaagtgaaggaagaggagcca
ggggctccaggaaaggagggagctgctgagggacccctggacccatccggttacaatcct
gccaagaacaactatcatcccgtggaagatgcctgctggaaaccgggccagaaggtccct
tacctggccgtggcccggacgtttgagaagatcgaggaggtgtctgctcggctccggatg
gtggagacgctgagcaacttgctgcgctctgtggtggccctgtcacctccagacctcctc
cctgtcctctacctcagcctcaaccaccttgggccaccccagcagggcctggagcttggc
gtgggtgatggtgtccttctcaaggcagtagcccaggccacaggtcggcagctggagtcc
gtccgggctgaggcagccgagaagggcgacgtggggctagtggccgagaacagccgcagc
acccagaggcttatgctgccaccacctccgctcactgcctccggggtcttcagcaagttc
cgcgacatcgccaggctcaccggcagtgcttccacagccaagaagatagacatcatcaaa
ggcctctttgtggcctgccgccactcagaagcccggttcatcgccaggtccctcagtgga
cggctgcgccttgggctggcagagcagtcagtgctggccgccctctcccaggccgtgagc
ctcacgcccccgggccaagaattcccaccagctgtggtggatgctgggaagggcaagaca
gcagaggccagaaagacatggctggaggagcaaggcatgatcctgaagcagacgttctgc
gaggttcccgacctggaccgaattatccctgtgctgctggagcatggcctggattgtctc
ccggagcactgcaagctgagcccagggattcctctgaagccaatgctggcccatcccacg
cgaggtgtcagcgaggtcctgaagcgctttgaagaggcagctttcacctgcgaatacaaa
tatgacgggcagagagcacagatccacgccctggaaggcggggaggtgaagatcttcagc
aggaatcaggaagacaacactgggaagtatccggacatcatcagccgcatccccaagatt
aaactcccatcggtcacatccttcatcctggacaccgaagccgtggcttgggaccgggaa
aagaagcagatccagccattccaagtgctcaccacccgcaaacgcaaggaggtggatgcg
tctgagatccaggtgcaggtgtgtttgtacgccttcgacctcatctacctcaatggagag
tccctggtacgtgagcccctttcccggcgccggcagctgctccgggagaactttgtggag
acggagggcgagtttgtcttcgctacctccctggacactaaggacgtcgagcagatcgcc
gagttcctggagcagtcggtgaaagactcctgtgaggggctgatggtaaagaccctggat
gttgatgccacctacgagatcgccaagagatcacacaactggctcaagctgaagaaggac
taccttgatggcgtgggtgacaccctggacctggtggtgatcggtgcctacctgggccgg
gggaagcgggccggccggtacgggggcttcctgctggcctcctatgacgaggacagtgag
gagctgcaggccatatgcaagcttggaactggcttcagcgacgaggagctggaggagcat
nnnngctcactgcaggccctggtgctgcccagcccacgcccttacgtgcggatagatggc
gccgtgactcccgaccactggctggaccccagcgctgtgtgggaggtgaagtgcgcagac
ctctccctctctcccatctaccctgctgcacggggcctgtgagtggatagtgacaagggg
atctcccttcgcttccctcggtttattcgagtccgtgaagacaagcagccggagcaggcc
accaccagtgcccaggtggcctgtttgtaccggaagcaaagtcagattcagaaccagcaa
ggcgaggactcaggctctgaccctgaagatacctactaa

DBGET integrated database retrieval system