KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 115835399
Entry
115835399         CDS       T03265                                 

Definition
(RefSeq) golgin subfamily A member 6C-like
  KO
K20358  golgin subfamily A member 2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    115835399
Membrane trafficking [BR:nle04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    115835399
SSDB
Motif
Pfam: GOLGA2L5 GM130_C
Other DBs
NCBI-GeneID: 115835399
NCBI-ProteinID: XP_030669686
LinkDB
Position
6
AA seq 723 aa
MWPQPYLPPHPMMLEETRQKKLAAAKKKLKEYQQRNSPAVPAGAKTKKKKTGSSPETTTS
SGCHSPGDSQYQELATALQSSSMTISQLNENIESLIRKQQKEQLEHQLEEAKKANNEIHK
AQTEQLEAINILTLEKEDLKTALYHTKRAARHFEEESKDLAGRLQYSLQRIQELERALCA
VSTQQREEDRSSSCSEAILQRRLQQTLKERALLNAHVTQVTESLKQVHLQREEYAHCIKA
ERARWQERMRKMSVETLLLKEEKKRDIHRIQELERSLSGLQNKMAEPPSLAPPAVTSVVE
QLQDEAKQLRKEVECLEGKLQSQVKNNQALSLLSKEQKQRLQEQEQRLQEQEEQRAREQE
RLCQQKEMLREQGKRLRKQEQRLRKEEERLRKEEERLRKEEERLWVQEKRLWEKDERLQK
QEERLRKWEERLALSQNHKLDKQLAEPQRGFEDLNNENKSAVHLEQGVMELQEKLDEEHL
EAASQRNQLLETQLSLMALPGEGDGEHLGSEEEEAPRPTPNIPEDLESREATSSFMDLLK
EKADGKEQVEKLELEVIQPSGATDGMRESFTVYESQGAVPNMRHQQMEDVIRLARNKEEI
KVKLLELQELVLPLAGNHEGHGKFLTAAQNPADEPAPGAPAPQELGAAGEQDDFYEVSLD
DSVEPAPGAAREGSPHDNPTAQQIVQLLPVMQDTQEHPRLPSKPCVPFFYRAAENREINI
III
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgtggccccaaccctatctccctccccaccccatgatgttagaagaaactcgacagaaa
aaattggcagcagccaagaaaaagctaaaagaatatcagcagaggaacagccctgctgtt
ccagcaggagcgaagacaaaaaagaaaaaaactggcagtagccctgagacaaccacttct
agtggttgccactcacctggggatagccagtaccaagaactagcaacagccctgcagtca
agctccatgacaatcagtcaactcaatgaaaacatagaatcattgataagaaaacagcag
aaggaacaactggaacatcagctggaagaagcaaagaaagcaaacaatgaaatacacaaa
gcacaaacggagcagttagaggcaatcaacatcctcacattggaaaaggaagacttgaag
accgccctttaccatactaaacgtgctgcccgacacttcgaagaagagtccaaggatctg
gctggccgcctgcaatactccctacagcgtattcaagaattggagcgggctctctgtgct
gtgtctacacagcagcgggaagaggacaggtcctcgagctgcagtgaagcgatcctccag
cggcggttacagcagaccctaaaggagcgggcgctgctgaacgcccacgtaacacaggtg
acagagtcacttaaacaagtccatctacaaagagaggagtatgcacattgtataaaagca
gagagggcccggtggcaggagaggatgagaaaaatgtcggtggagactctcctattgaag
gaggagaagaagcgtgacatacatcggatacaggagctggagaggagcttgtccggactc
caaaacaagatggctgagcccccatccctggcgcccccagcagtgacctctgtggtggag
cagctacaggatgaggccaaacagctgaggaaggaggtggagtgtctggagggaaagctc
caatcccaggtgaaaaacaatcaggccttgagtctcctgagcaaggaacaaaagcagagg
ctccaggagcaggagcagaggctccaagagcaggaggagcagagggcgcgggagcaggag
agactgtgtcaacaaaaggaaatgctacgggagcagggcaagaggctgcgaaagcaggag
cagaggctgcgaaaggaggaggaaaggctgcgaaaggaggaggaaaggctgcgaaaggag
gaggaaaggctctgggtccaggaaaagaggctgtgggagaaggacgagaggctacagaag
caggaggagaggctgcgaaagtgggaggagagactcgcgctctcccagaaccacaagctc
gacaagcagctggccgagccacagcgcggcttcgaggatctgaacaacgagaacaagagc
gcagtgcatttggagcagggagtaatggagctgcaggagaagctagacgaggagcaccta
gaagctgccagccagcggaaccaactgctggagacccagttgagcctcatggctctccct
ggagaaggagatggagaacatctgggcagtgaggaggaggaggcgcctcggcccacgcca
aacatcccggaggacctggagagccgggaggccacgagcagctttatggacctcctgaag
gagaaggcggacgggaaggagcaggtggagaaactagagcttgaagtcatccagccctct
ggagcgacagatggcatgagagagtccttcaccgtatatgaaagccagggggcagtgcca
aacatgcggcaccagcagatggaggatgtcatcaggctggcccggaacaaggaggagatc
aaggtgaagctgctggagctgcaagagctggtgttgccccttgcgggcaaccacgagggt
catggcaaattcctcaccgctgcccagaaccctgctgatgagcccgctccaggggcccca
gccccccaggaacttggggctgccggtgagcaggatgatttttatgaggtgagcctggac
gacagcgtggagcctgcaccaggagcggccagggagggttctccccatgacaaccccact
gcacagcagatcgtgcagctgcttcctgtaatgcaggacacccaggagcacccacgcttg
cctagcaaaccctgcgtgccattcttttaccgggcagccgagaacagggagataaacatc
atcatcatctaa

DBGET integrated database retrieval system