KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0796Help
Entry
NMA0796           CDS       T00031                                 

Definition
(GenBank) hypothetical protein NMA0796
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding_2 Acetyltransf_3 Acetyltransf_4 Acetyltransf_1 Succ_CoA_lig FR47 GNAT_acetyltran TYW3 CoA_binding Acetyltransf_10
Motif
Other DBs
NCBI-ProteinID: CAM08042
UniProt: A0A0U1RHY5
LinkDB All DBs
Position
complement(779736..782162)
Genome map
AA seq 808 aa AA seqDB search
MSAQTDPGYFFMPNHIILIGASERPYSLGERVLSNLLSTPFQGKITPVNPRHHTIAGLPA
YTSLNKIPGNADLIIAVTLPDSYDTLFKTCRKKQLRHIILIQDWDSLPAAELHTAETAIR
KHHGNGLNITACTTAGIQLPSLGLNISTQDGYAAGHTAILTGNAAVSRQIDNILNKLRQG
TSRHISLHPGISPITSADWLNRFGHSLHTKTAVLHHNPEEDQRKLFSAIRQFTRHTPLIL
HITCRTTETDRAVLHCLARHCNFLISFNADDLEAALRAQLSDLPPLSRLDILSDTPAEWL
NAHAPKTLALHFPNLPHHIRNGHLTGTPTPSICHDIASRQLARPDTQAVLTILSPSGHED
YKKTARALIRLSEQTAKPLLVSSPFSDGITHFDTPTQAIRTLSYRNTAAALKQAQLDIAP
PQPCRLKTPQPQNIKKALEAADPALIAEALHLPPYRHTTHNAVQFQFGSHPLYGDILTAC
CNGQTTAVLPPFTTLDSRHLARFAELDGTQTLDQFLHTLTVIPEYRQHILGITLNLNGGQ
YSSDFILKTPETHDTPKRKNTGKAAQTLEHAAAKMQSAAAYLKHKNPTAAEFLRHTSEAA
AELLGSKTETGAAVPNVLAPYPAAHLKTLSLKNNTTVTITPLLPEDAEAKQQFVRSLSPE
ARYTRFMTHTNELPAAALARLCNPDYHCEAAWTARDADSNIVAVVRHSRLNRNECEFGIT
LAEHMRGSGLAQKMMELIIQTAAQQGYRTMSADILKTNTPMIKLAEKSGFTLKESDTEKN
LYRAYLNLAADKTTEKTNKNLRTDHKIT
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcacaaaccgatccgggctactttttcatgcccaaccacattattctgataggc
gcgagcgaacgtccgtacagcctgggcgaacgcgtactcagcaacctgctgagtacgccc
tttcaaggaaaaatcacccccgtaaacccgcgccaccacaccatagctgggcttcccgcc
tacaccagcctcaacaaaatccccggcaatgcagacctgattattgccgttaccctaccc
gacagttacgacaccctcttcaaaacctgccgcaaaaagcagctccgacacatcatcctc
atacaggactgggacagcctgcctgccgcagaactgcacaccgccgaaactgccatccgc
aaacaccacggcaacggactcaacatcaccgcctgcaccaccgcaggcatccaactgccc
tcactcggacttaacatcagtacccaagacggatacgccgcaggccataccgccatactg
accggcaatgccgccgtcagccgccaaatcgacaacatcctgaacaaactccgtcaaggc
acatcccgccacatcagcctgcatcccggcatcagccccatcacatccgccgattggctc
aaccgcttcggacacagcctgcacaccaaaaccgccgtcctacaccacaaccctgaagag
gatcagcgcaaactgttcagcgcaatccgccaatttacccgccatacgccgctgattctc
cacatcacctgccgcacgacagaaaccgaccgtgccgtactgcactgcctcgcccgacac
tgcaacttcctcatcagtttcaacgccgacgacctcgaagccgcactgcgcgcccaactg
tccgaccttccacccctgtcccgactcgacatcctgtccgacacgcctgccgaatggctg
aacgcgcacgcgccaaaaaccctcgccctccactttcccaaccttccccaccacatccgc
aacggacacctgaccggcacacccacaccctcaatctgccacgacatcgcctcacgtcag
cttgcccgccccgacacccaagccgtcctgaccatcctcagcccctccggacacgaggat
tacaaaaaaacagcacgcgcccttatccgcctgtccgaacagaccgccaaacccctgctc
gtcagcagccccttttcagacggcataacacatttcgacacccccactcaggcaatccgc
accctttcctaccgcaacaccgccgccgccctgaaacaggcacagctcgacattgcaccg
ccgcaaccgtgccgtctgaaaacaccgcaaccccaaaacatcaaaaaagccctcgaagcc
gccgaccccgccctaatcgccgaagccctgcacctccccccctaccggcacactacccat
aacgccgtccaattccaattcggcagccaccccctctatggcgacatcctgaccgcatgc
tgcaacggacaaaccactgccgtactcccgccgtttaccacgctcgacagccgccacctt
gcccgctttgccgaactcgacggcacacaaaccctcgaccagttcctgcacacactgacc
gtcattcccgaataccgccaacacattctcggcatcaccctcaacctcaacggcggacaa
tacagcagcgatttcatcttaaagacacccgaaacacacgacacgcccaaacgcaagaac
acaggcaaagccgcccaaaccctcgaacatgccgccgcaaaaatgcagagtgccgccgca
tacctgaaacacaaaaacccgacagccgccgaatttctccgccacacaagcgaagccgcc
gcagaactgctcggcagcaaaaccgaaaccggagcagccgtacccaacgtacttgccccc
tatcccgcagcacacctcaaaacactgtccctaaaaaacaacacgaccgttaccattacc
ccccttttgcccgaagacgcagaagccaaacagcagttcgtccgcagcctcagccccgaa
gcacggtacacacgcttcatgacccacaccaacgaactgcccgcagccgcgttggcacgc
ctgtgcaaccccgactaccactgtgaagccgcatggacggcaagggatgccgacagcaac
atcgtcgccgtcgtccgccacagccgcctgaaccgcaacgaatgcgaattcggcatcaca
ctggcggaacatatgcgcggcagcggactggcacagaaaatgatggaactcatcatccaa
accgccgcacagcaaggctaccggactatgagtgccgacattctcaaaaccaatactccc
atgatcaaacttgctgaaaaatcaggatttaccctcaaggaatcggacaccgaaaaaaac
ctgtaccgcgcatatctgaaccttgcggcagacaaaacaacagaaaaaacaaataaaaac
ttgcgcaccgaccacaaaataacctaa

DBGET integrated database retrieval system