KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0801Help
Entry
NMA0801           CDS       T00031                                 

Definition
(GenBank) hypothetical protein NMA0801
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2069
Motif
Other DBs
NCBI-ProteinID: CAM08046
UniProt: A0A0U1RHY9
LinkDB All DBs
Position
complement(786371..786724)
Genome map
AA seq 117 aa AA seqDB search
MNKQTAYLLASFSLIALIILSLSWELWIAPLRPGGSWLALKALPLCLPLSGILKKKIYTY
QYSSMLVLIYFAEAVMRLFDAYPAEQICAALSAVFSIIFFISCLSFVKQYKETNNAR
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaacaaaccgcttacctccttgcctctttcagcctgatcgcactgataatccta
tccctttcctgggaactgtggattgcaccgttgcgcccgggcggctcgtggctcgcgctc
aaagccctccccctctgtctgccgctttcaggcatcttgaaaaagaaaatctatacctac
caatacagctccatgctggttctgatttattttgccgaagccgttatgcgcctgttcgac
gcttatccggcagaacagatttgcgccgcgctttccgcagtattcagcatcatcttcttc
atatcctgcctgtcgttcgtcaaacaatacaaggaaacaaacaatgcccgctga

DBGET integrated database retrieval system