KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0815Help
Entry
NMA0815           CDS       T00031                                 

Definition
(GenBank) putative 30S ribosomal protein S15
  KO
K02956  small subunit ribosomal protein S15
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nma00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NMA0815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nma03011]
    NMA0815
Ribosome [BR:nma03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    NMA0815
  Bacteria
    NMA0815
  Archaea
    NMA0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S15
Motif
Other DBs
NCBI-ProteinID: CAM08057
UniProt: Q9JQT2
LinkDB All DBs
Position
796138..796407
Genome map
AA seq 89 aa AA seqDB search
MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFKANPKDHHSRRGLLKMV
SQRRRLLAYLRRTQPDTYRALITRLGLRK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaccgtagaacaaaaagcacaaatcgttaaagatttccaacgcaaagaaggc
gacaccggctcttccgaagtacaagtcgctctgttgactttccgcatcaacgacctgacc
ccccacttcaaagccaaccccaaagaccaccacagccgtcgcggcctgttgaaaatggtc
agccaacgccgccgcctgctggcctacttgcgccgtacccagcccgatacgtatcgcgcg
ttgattacccgcttgggtctgcgtaaataa

DBGET integrated database retrieval system