KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0832Help
Entry
NMA0832           CDS       T00031                                 

Definition
(GenBank) putative glycosyl transferase
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 DDHD Glyco_tranf_2_4 Zip PPL5 DUF5308 SLC12 DUF4638 Presenilin MID_MedPIWI RR_TM4-6 DUF1387 Ndc1_Nup Tim54 DUF908 Pex14_N
Motif
Other DBs
NCBI-ProteinID: CAM08072
UniProt: A0A0U1RI07
LinkDB All DBs
Position
814675..815826
Genome map
AA seq 383 aa AA seqDB search
MDLSIVVPIYNVESYLEACLSSIEPILSNENVELILVNDGSKDGSEDICYKYIDKTTNNK
QQTTNNKQQTTNNKQQTTNNKQQTTNNKQQTTNNKQQTTNNKQQTTNNKQQTTNNKHRTP
NIKYIYQDNQGTAEARNTGIKNSNGKYIVFIDSDDFINCQVLLDFLSKDDIDMPDVVFLN
AVKYDKGSVSHFGEDYQPEKILNQSKVEVLKGLCRFRKFPGSACNKIIKRELIIKEKLFF
EKEVYAEDIEWSMRLFNAATTFSYLDGCYYYYRQGRKDSKTGTVSEKSIKSLLYILEKNA
EMEFNRDISSYLYSFLSYEYLVLLFIMTSKNIACDADIKRRAYHLRFMLLKSNKLIYKLI
FPIITLFGVDITGRILKAIRGNI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggatttaagtatcgtagttcccatttataatgtcgaaagttatttggaagcgtgttta
agttccatagaacctatattaagtaatgaaaatgtcgaacttatccttgtgaatgacggg
tcaaaagacggaagtgaagatatatgttataaatatatagataaaacaacaaacaacaaa
caacaaacaacaaacaacaaacaacaaacaacaaacaacaaacaacaaacaacaaacaac
aaacaacaaacaacaaacaacaaacaacaaacaacaaacaacaaacaacaaacaacaaac
aacaaacaacaaacaacaaacaacaaacaacaaacaacaaacaacaaacaccggacacca
aatatcaaatatatctatcaggataaccaagggacggcagaagctaggaataccggaata
aaaaattcaaacggaaaatatatagtctttattgattcggatgattttattaattgtcag
gtcttgctggattttcttagtaaagatgatattgatatgccggatgtggtttttttaaat
gcggttaaatatgataagggaagtgtttcacattttggcgaagattatcagcctgaaaaa
atactcaatcaatccaaagtcgaagttttgaaaggattatgccgatttagaaaatttccg
ggttcggcgtgtaataagattataaaaagggaattgattatcaaagaaaaactatttttt
gaaaaagaggtttatgccgaagatatcgaatggtcaatgagattatttaatgcggcaaca
actttttcttatttggacggttgttattactattatcggcagggaagaaaagattctaaa
acaggaactgtttcggaaaaaagtataaagtcattattatatattttggagaaaaatgcg
gaaatggaatttaatagggatatatcaagttatctttattcttttctttcctacgaatat
ctcgttttgctttttatcatgacgagtaaaaatatagcgtgtgatgctgatataaaaaga
agggcgtatcatttaaggtttatgctgttaaagtccaataaattgatatataagctgata
ttcccgataatcacattattcggggtcgatattacaggcaggattttaaaagcaatcagg
gggaatatttaa

DBGET integrated database retrieval system