KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0841Help
Entry
NMA0841           CDS       T00031                                 

Definition
(GenBank) putative phosphate acyltransferase
  KO
K13788  phosphate acetyltransferase [EC:2.3.1.8]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00430  Taurine and hypotaurine metabolism
nma00620  Pyruvate metabolism
nma00640  Propanoate metabolism
nma00680  Methane metabolism
nma01100  Metabolic pathways
nma01120  Microbial metabolism in diverse environments
nma01200  Carbon metabolism
Module
nma_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:nma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMA0841
   00640 Propanoate metabolism
    NMA0841
  09102 Energy metabolism
   00680 Methane metabolism
    NMA0841
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NMA0841
Enzymes [BR:nma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     NMA0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB AAA_26
Motif
Other DBs
NCBI-ProteinID: CAM08079
UniProt: A0A0U1RI09
LinkDB All DBs
Position
complement(821220..822722)
Genome map
AA seq 500 aa AA seqDB search
MAKVLIVPVSAGLDASAVAQAFAKALDAQIFQAVDATAETLLAQGKSDDWFDALVGKVAA
LDAANLVIEGIAPDADKIYLAGKNVELALSLDAAAVFAVRSDNADADELANRLNLAKQFF
AAAPGVLEGFVVDGAAASVAEAAAEKTGLTFFGSSDALKDVSVLAGREAKRLSPAQFRYN
LIDFARQADKRIVLPEGAEPRTVQAAAICHEKGIARCVLLAKREEVEAVAKERGISLPDS
LEIIDPASLVEQYVEPMCELRKSKGLTPEDARKQLQDTVVLGTMMMAQNDVDGLVSGAVH
TTANTIRPALQLIKTAPGASLVSSVFFMLLPNQVLVFGDCAVNPNPTAQQLADIAIQSAD
SAKAFGIDPKVAMISYSTVNSGSGPDVDTVIEATKLAQEKRPDLAIDGPLQYDAATVPGV
GKSKAPGSPVAGQATVLVFPDLNTGNCTYKAVQRSANVLSVGPLLQGLRKPVNDLSRGAL
VEDIVFTIALTAVQAKQMEG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtactcatcgtacccgtatctgccggactggacgcctccgccgtcgcacaa
gcctttgcaaaagcactggacgcacaaattttccaagccgttgacgcaaccgccgaaacc
ctgctcgcgcaaggcaaaagcgacgactggttcgacgcactggtcggcaaagttgccgca
ctcgatgccgccaacctcgtcatcgaaggcatcgcgcccgatgccgacaaaatctacctc
gcaggcaaaaacgtcgaactggcattgtcccttgacgcggcagccgtcttcgccgtccgt
tccgacaacgccgatgccgacgaactggcaaatcggctgaaccttgccaaacagttcttc
gccgccgcgccgggcgtattggaaggttttgtcgtggacggcgcggcagcctccgttgcc
gaagcggcagccgaaaaaaccggcctgaccttcttcggttcgagcgacgcgctgaaagac
gtatccgtattggcaggccgcgaagcaaaacgcctgtcgccggcgcaattccgctacaac
ctgatcgacttcgcccgccaagccgacaaacgcatcgtcctgcccgagggcgcagaaccc
cgcaccgtccaagccgccgccatctgccacgaaaaaggcattgcccgctgcgtcctgctt
gccaaacgcgaagaagtcgaagccgttgccaaagaacgcggcatcagcctgcccgactct
ttggaaatcatcgatcccgcctcattggtcgaacaatacgtcgagccgatgtgcgaactg
cgcaaatccaaaggcctgacacccgaagacgcgcgcaagcaactgcaagacaccgtggta
ctcggtacgatgatgatggcgcaaaacgatgtggacggcctggtatccggtgccgttcat
acgaccgccaacaccatccgccctgctttgcaactgattaaaaccgcaccgggtgcaagc
ctcgtatccagcgtattctttatgctgctacccaaccaagtcctcgtcttcggcgactgc
gcggttaatccgaacccgactgcgcaacagcttgccgacatcgccatccagtctgccgat
tccgcaaaagccttcggcatcgacccgaaagtggccatgatttcctactctacggtcaac
tccggcagcggtcccgatgtcgataccgtcatcgaagcaaccaaacttgcccaagaaaaa
cgccccgatctcgccatcgacggcccgctgcaatatgatgcggcaaccgtgccgggtgtg
ggcaaatccaaagctccgggcagcccggtggcaggacaggcaaccgttttggtcttcccc
gacctgaacaccggcaactgcacctataaagccgtccaacgcagtgccaacgtcttaagc
gtcggcccgctgctgcaaggcctgcgcaaaccggtcaacgacctgtcgcgcggcgcgctg
gtggaagacatcgtgttcaccatcgccctgactgccgttcaggcaaaacaaatggaaggc
tga

DBGET integrated database retrieval system