KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA0892Help
Entry
NMA0892           CDS       T00031                                 

Definition
(GenBank) putative amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00230  Purine metabolism
nma00250  Alanine, aspartate and glutamate metabolism
nma01100  Metabolic pathways
nma01110  Biosynthesis of secondary metabolites
nma01130  Biosynthesis of antibiotics
Module
nma_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMA0892
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMA0892
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nma01002]
    NMA0892
Enzymes [BR:nma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     NMA0892
Peptidases and inhibitors [BR:nma01002]
 Cysteine peptidases
  Family C44
   NMA0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_7 Pribosyltran GATase_4 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CAM08127
UniProt: A0A0U1RI37
LinkDB All DBs
Position
complement(864689..866233)
Genome map
AA seq 514 aa AA seqDB search
MCGVLGLVSHEPVNQLLYDGLQMLQHRGQDAAGIATAEGGTFHMHKGKGMVREVFRTRNM
RDLVGNAGIAHVRYPTAGNAGSSAEAQPFYVSSPFGIVLAHNGNLTNTAELYENVCNKHL
RHVNTSSDSEVLLNVFAHELRREVSKNADPHRLNADNIFNAVAEVHRLVHGAYGVVAMIA
GYGMLAFRDPYGIRPLVLGSQTDSEGRKSYAVASESVAFNALAYDLERDIRPGEAVFVGF
DGTIIARQCSDKAKLSPCLFEYVYFARPDSVIDGVSVYQSRLDMGVSLAEKIKRELPVDG
IDVVMPIPDTSRPSAMELAVHLKKPYREGLIKNRYIGRTFIMPGQATRKKSVRQKLSPME
TEFAGKSVLLVDDSIVRGTTSREIVEMVRAAGARKVYIASAAPEVRYPNVYGIDMPTREE
LIANGRSAAEIAAEIGADGIVFQDLGDLEAVVKALNPKIESFDSSCFNGIYQTGDIDDAY
LDRLSAEKSGCGGLKIHPSRMEHSISISDAGDEE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcgtattaggtttggtcagtcatgaacccgtgaaccagcttctgtacgacggt
ttgcagatgttgcagcacagggggcaggatgcggcgggcattgcaacggcggaaggcggt
accttccatatgcacaaaggcaaaggcatggtgcgcgaagtgttccgcacacgcaatatg
cgcgatttggtcggcaacgccggcatcgcccacgtccgttatcctactgcgggcaacgcg
ggcagcagcgcggaggcgcagcctttctacgtcagctcgccgttcggcatcgttttggcg
cacaacggcaacctcaccaacacggccgaactttatgaaaacgtgtgcaacaaacacctg
cgccacgtcaacaccagctccgattccgaagtcttgctcaacgtattcgcgcacgaattg
cgccgcgaagtctctaaaaacgccgacccgcaccggctcaatgccgacaatattttcaac
gccgttgccgaagtccaccgcctggtgcacggcgcatacggtgtggttgccatgattgcg
ggctacggtatgcttgccttccgcgacccttacggcatccgcccgctggtattgggttcg
caaaccgacagcgaaggcaggaaatcctatgccgtcgcctccgaatccgtcgccttcaac
gcgcttgcctacgatttggaacgcgatatccggccgggcgaagcggtatttgtcggcttt
gacggcacaatcatcgcccgacaatgcagcgataaggccaaactcagcccctgccttttt
gaatacgtctattttgcccgtcccgactccgtgattgacggcgtgtccgtttaccagtcg
cgcttggatatgggcgtgtccttggcggaaaaaatcaaacgcgagctgcccgtggacggc
atcgatgtcgtgatgcccatccccgacaccagccgccccagcgcgatggagcttgctgtc
cacctcaaaaagccttaccgcgaaggtttgattaaaaaccgctatatcggccgcaccttt
attatgcccggccaggcgacgcgcaaaaaatccgtgcgccaaaaactcagcccgatggaa
accgaatttgcaggcaaaagcgtgttgctggtggacgactccatcgtgcgcggtacgacc
agccgtgaaatcgtcgaaatggtacgcgcggctggcgcgcgcaaagtctatatcgcctcc
gccgcgcccgaagtgcgctatcccaacgtatacggcatcgatatgcccacgcgcgaagag
ttgattgccaatgggcgcagcgcggcggaaatcgccgccgaaatcggcgcggacggcatc
gtgtttcaagacttgggcgatttggaagccgtcgtcaaagcactcaacccgaaaatcgaa
tccttcgattcgtcctgtttcaacggcatttatcagaccggcgacatcgatgatgcctac
ctcgaccgcctgtctgccgagaaatccggctgcggcggtctgaaaatccacccgagcagg
atggaacacagcatcagcatcagcgatgcgggcgacgaagaataa

DBGET integrated database retrieval system