KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1149Help
Entry
NMA1149           CDS       T00031                                 

Definition
(GenBank) putative 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00020  Citrate cycle (TCA cycle)
nma00310  Lysine degradation
nma00380  Tryptophan metabolism
nma01100  Metabolic pathways
nma01110  Biosynthesis of secondary metabolites
nma01120  Microbial metabolism in diverse environments
nma01130  Biosynthesis of antibiotics
nma01200  Carbon metabolism
Module
nma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMA1149
  09105 Amino acid metabolism
   00310 Lysine degradation
    NMA1149
   00380 Tryptophan metabolism
    NMA1149
Enzymes [BR:nma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NMA1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: CAM08355
UniProt: A0A0U1RIJ6
LinkDB All DBs
Position
1097475..1100303
Genome map
AA seq 942 aa AA seqDB search
MMDEKLNFSYLFGSNAPYIEELYEAFLENPDAVDEKWKQYFTDLSKQPGTVAVDVAHTPI
RESFVTLAKKKIASAVAGGADEAMLKKQVSVLRLISAYRIQGVGAAQLDPLKRIPPRDIE
ALDPKFHGLSDADMALQFNMGEGDFANRGKLPLSQIISNLKQTYCGHIALEYIYIPNTEE
RRWVRNYFESVLSTPHYNADQKRRILKEMTAAETLERYLHTKYVGQKRFGVEGGESAIAG
LNYLIQNAGKDGVEEVIIGMAHRGRLNVLVNILGKKPGDLFAEFEGRAEIKLPSGDVKYH
MGFSSDIATPHGPMHVSLAFNPSHLEIVNPVVEGSARAKQKRLGENGRDKVLPVLIHGDS
AFIGLGVNQATFNLSKTRGYTTGGTVHIVINNQIGFTTSDIRDTRSTVHCTDIAKMVSAP
VIHVNGDDPERVCFAIQAALDYRKKFHKDIVIDVVCYRKWGHNEGDDPTLTQPMMYKKVS
QHPGARALYTEQLIAEGVVTQAEADGYIQAYRDALDKGEHVEQTTLSNFQRTQIDWSKYQ
GKDWREHIETGLPAADIERLTEKFTAVPEGFALHPTAKRVIEARKAMASGKQAIDWGMAE
TLAYASLVTKGHGVRISGEDSGRGTFSHRHAVLHDQKREKWDDGTYVPLRHMGEGMGEFL
VIDSILNEEAVMAFEYGFACSAPDKLTIWEAQFGDFANGAQVTIDQFLSSGETKWGRLCG
LTTILPHGYDGQGPEHSSARVERWLQLCSENNMQVIMPSEASQMFHLLQRQVLGSYRKPL
VIFMSKRLLRFKGAMSPLENFTEGSTFRPVIGDTAERASNDSVKRVVLCAGQVYYDLEAG
RAERKLEDDVAIVRVEQLYPFPYDEVKAELAKYPNAKSVVWAQEEPKNQGAFYQIRHRIE
DVISEEQKLSYAGRPSSASPAVGYSSKHIAQLKQLVEDALAL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgaaaaactcaatttctcttacctgttcggttcaaacgcaccttacattgag
gaattgtacgaggcttttttggaaaaccccgatgcggttgatgaaaaatggaagcagtat
ttcaccgatttgagcaaacagccggggacggttgctgtcgatgtcgcacacacaccgatt
cgcgaatcatttgttactttggcgaaaaagaaaattgcatctgccgttgcgggcggtgcg
gatgaggcaatgctgaaaaagcaagtcagcgttttacggctgatttccgcctatcgtatc
caaggcgtgggtgcagcccaacttgatccgctcaaacgtatccccccgcgcgatattgaa
gccctcgatccgaaattccacggtctgtcagatgccgatatggcgcttcaattcaatatg
ggcgagggcgattttgccaatcgcggcaaactgcctttgtcccaaatcatcagcaacctc
aaacaaacctactgcggccacatcgcattggaatatatctatattcccaataccgaagag
cgccgctgggtacgcaattattttgaaagcgtattgtccacaccgcattacaatgccgat
caaaaacgccgtatcttgaaagagatgactgctgccgagactttggaacgttatctgcat
accaaatatgtcggtcagaaacgtttcggtgtcgaaggcggcgaaagcgcgattgccggt
ttgaactacctgattcaaaacgccggtaaagacggcgtggaagaagtcatcatcggtatg
gcgcaccgtggccgtctgaatgttttggtgaacattttgggtaaaaaacccggagatttg
ttcgctgagtttgaaggccgtgccgaaatcaaattgcctagcggcgacgtgaaataccac
atgggcttcagctccgacatcgccactccacatggtccgatgcacgtttctttggcgttc
aacccgtcacacttggaaatcgttaacccggtagtcgaaggttctgcacgcgccaagcag
aaacgtttgggcgaaaacggccgcgataaagtcttgcccgtattgattcacggcgactcc
gcatttatcggtttgggtgtcaaccaagcgacattcaatctgtctaaaacgcgcggttat
accaccggcggtacggttcatatcgtcatcaacaatcaaatcggctttaccacttccgat
atccgcgatacccgttcaaccgtacactgtaccgatatcgcaaaaatggtttccgctccg
gttatccatgtgaacggcgatgatcctgagcgtgtttgctttgccatccaagccgctttg
gattaccgcaaaaaattccataaagacatcgtgatcgacgttgtctgctaccgtaaatgg
ggccacaacgagggcgacgatccgaccttgacccaaccgatgatgtacaaaaaagtatcg
caacacccgggtgcgcgtgctttgtacaccgagcaactgattgccgaaggcgtggtaacc
caagccgaggctgacggttacatccaagcctaccgtgatgctttggataaaggcgaacac
gtcgagcaaacaacgttgagcaacttccaacgcacacaaattgactggagcaaataccaa
ggtaaagattggcgcgaacacatcgaaaccggtttgcctgccgcggatattgagcgtctt
accgagaaatttaccgccgtaccggaaggctttgccctgcatccgactgcaaaacgtgtg
attgaagcgcgtaaagccatggcatccggcaaacaagccatcgactggggtatggccgaa
accttggcatacgcaagccttgtaaccaaaggtcatggcgtgcgtatctccggtgaggac
tccggccgcggtacgttctcgcaccgccacgccgtattgcacgatcaaaaacgcgaaaaa
tgggacgacggtacttatgttcctctgcgccatatgggcgaaggaatgggcgagttcctg
gttatcgactccattttgaacgaagaagccgtgatggcgttcgagtacggctttgcctgc
tccgcgcctgacaagctgaccatttgggaagctcaatttggtgacttcgccaacggcgcg
caagtgacgattgatcaattcctgtcgtcaggcgaaaccaaatggggtcgcttgtgcggt
ctgaccaccatcctgccgcacggttacgacggtcaaggccctgagcactcttctgcacgc
gtagaacgctggttgcaactgtgttctgagaacaatatgcaagtcatcatgccatctgaa
gcgtcgcaaatgttccacctcttgcaacgtcaagtcttaggttcataccgcaaaccgctg
gtaattttcatgtccaaacgcctgttgcgattcaaaggggcaatgagcccgctggaaaac
ttcaccgaaggttcgactttccgtccggttatcggcgataccgccgaacgcgcaagcaac
gacagcgtgaaacgcgtggtattgtgtgccggtcaggtttactatgacttggaagccggt
cgagccgaacgtaaactggaagatgatgttgcgattgtccgcgttgagcagctgtatccg
ttcccatacgatgaggttaaagctgaactggcgaaatatccgaacgcaaaatctgtggtt
tgggcgcaagaagagccgaaaaaccaaggcgcgttctaccaaatccgccaccgcatcgaa
gacgttatcagcgaagagcaaaaactgtcttatgctggtcgtccaagcagcgcatcgcct
gcagtgggctactcaagcaaacacattgctcaattgaaacaattggttgaagacgctttg
gcgttgtaa

DBGET integrated database retrieval system