KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA1570Help
Entry
NMA1570           CDS       T00031                                 

Definition
(GenBank) Glu-tRNAGln amidotransferase subunit A
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00970  Aminoacyl-tRNA biosynthesis
nma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nma00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMA1570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nma03029]
    NMA1570
Enzymes [BR:nma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NMA1570
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NMA1570
Mitochondrial biogenesis [BR:nma03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NMA1570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY DUF3580
Motif
Other DBs
NCBI-ProteinID: CAM08715
UniProt: Q9JTZ3
LinkDB All DBs
Position
1473638..1475068
Genome map
AA seq 476 aa AA seqDB search
MTWETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHAGVVECALPGVLPVMNREVVEKAI
KLGLALDAKINRKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDDVKTINVTR
AHMEEDAGKSVHEGLNGATGIDLNRAGTPLLEVVSEPEMRSAAEAVAYAKALHSLVTWLN
ICDGNMAEGSFRVDANVSVRPKGQAEFGTRREIKNLNSFRFLEQAINYEAEAQIEILEDG
GKVQQATMLFDPEKGETRVMRLKEDAHDYRYFPDPDLLPVIISDDRLQKAKAEMPELPKE
MAARFVADYGVSDYDARLLTASRVQAAYFEEAAKESGQGKLTANWMNGELAATLNKEGME
LADSPITAPRLAALVGKIADGTLSSKLAKKAFEAMWAEPEASIAEIIEKHGLQQMTDTGA
IEAMVDEVLANNAKAVEQFKSGNEKALNAIVGQVMKASKGKANPAQVQELIKAKLA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacctgggaaaccgtaatcggcttggaaatccacgtccaattgaacaccaaatccaaa
atcttcagcggcgcatcgaccgcattcggcgcagaacccaacgcgcacgccggcgtggtg
gaatgtgctttgccgggcgtactgccggtaatgaaccgagaagtcgttgaaaaagccatc
aaattgggtttggctttggatgcgaaaatcaaccggaaaaacgtgttcgaccgtaaaaac
tacttctatcccgacttaccaaaaggctatcaaatcagccagttggacttaccgattgtc
gaacacggcaaattggaaatcgtagtcggcgacgatgtgaaaaccatcaacgtaacccgc
gcccatatggaagaagacgcgggcaagtccgtacatgaaggcttgaacggcgcgaccggt
atcgatttgaaccgcgccggcacgcctttattggaagtcgtatccgaacccgaaatgcgc
tccgccgccgaagccgttgcctacgccaaagccttgcacagcttggtaacctggctgaac
atttgcgacggcaatatggcggaaggttcgttccgcgtcgatgccaacgtatccgttcgc
ccgaaaggtcaagcggaattcggcacgcgccgcgagattaaaaacctcaattccttccgt
ttcttggagcaggcgattaattacgaagcagaagcgcaaatcgagattttggaagacggc
ggcaaagtacagcaggcaacgatgctgtttgatcccgaaaaaggcgaaacccgcgtaatg
cgcctgaaagaagacgcgcacgactaccgctacttccctgaccccgatttgctgcccgtc
atcatttcagacgaccggttgcaaaaagcaaaagcagaaatgcccgagctgccaaaagaa
atggcggcgcgtttcgtggcggattatggcgtgagcgactacgacgcgcgcctgctcact
gccagccgcgtgcaggctgcctattttgaagaagccgctaaagagagcggacaaggcaag
ctgactgccaactggatgaacggcgaacttgccgccacgctgaacaaagaaggcatggaa
cttgccgacagcccgattaccgccccacgcctcgccgctctggtaggcaaaatcgccgac
ggcacattaagcagcaaattggcgaaaaaagcctttgaagccatgtgggctgaacccgaa
gcctccattgccgaaatcattgaaaaacacggtttgcaacagatgaccgataccggcgcg
attgaagcgatggtagacgaagtgctggcaaacaatgcaaaagccgtggaacagttcaaa
tccggcaacgaaaaagccctgaatgcgattgtggggcaagtgatgaaggccagcaaaggc
aaagccaatcccgcgcaggttcaagagctgattaaagccaaacttgcctga

DBGET integrated database retrieval system