KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA2039Help
Entry
NMA2039           CDS       T00031                                 

Definition
(GenBank) chorismate mutase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nma01100  Metabolic pathways
nma01110  Biosynthesis of secondary metabolites
nma01130  Biosynthesis of antibiotics
nma01230  Biosynthesis of amino acids
Module
nma_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
nma_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:nma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMA2039
Enzymes [BR:nma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     NMA2039
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     NMA2039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT YjgF_endoribonc ACT_4
Motif
Other DBs
NCBI-ProteinID: CAM09143
UniProt: A0A0U1RK75
LinkDB All DBs
Position
complement(1979849..1980976)
Genome map
AA seq 375 aa AA seqDB search
MLECTANHRSGEIMSQTIDELLLPHRNAIDTIDAEILRLLNERAQHAHAIGELKGTGAVY
RPEREVAVLRRIQDLNKGPLPDESVARLFREVMSECLAVERPLTIAYLGPQGTFTQQAAI
KHFGHAAHTMACPTIDNCFKQVETRQADYLVAPVENSTEGSVGRTLDLLAVTALQACGEV
VLRIHHNLLRKNNGSTEGIAKVFSHAQALAQCNDWLGRHLPNAERIAVSSNAEAARLVAE
SDDGTVAAIAGRTAAEIYGLDMVAECIEDEPNNTTRFLVMGHHETGASGSDKTSLAVSAP
NRAGAVASLLQPLTESGISMTKFESRPSKSVLWEYLFFIDIEGHRRDAQIQTALERLGER
ASFVKVIGSYPTAVL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttagaatgcacggcaaaccaccgttcaggcgaaattatgtcccaaactatcgacgaa
ctcctccttccccaccgcaacgccatcgacaccatcgatgccgaaatcctgcgcctgctc
aacgaacgtgcgcaacacgcccacgccatcggcgagctgaaaggcacgggcgcagtgtac
cgtcccgaacgcgaagtcgccgtgttgcgccgcattcaggatttgaacaaaggcccgctg
cccgacgaatcggtagcacgcctgtttcgggaagtgatgagcgagtgcctcgccgtcgaa
cgcccgctgaccatcgcctatctggggccgcagggcacgtttacccagcaggcggcgatc
aagcatttcggacacgccgcgcacaccatggcgtgtccgaccatagacaactgcttcaag
caggttgaaacccgtcaggcggattatctggtcgcgcccgtggaaaactcgaccgaaggc
tcggtcgggcgcacgttggatttgcttgccgttaccgcgttgcaggcgtgcggcgaagtc
gttttgcgcatccaccacaaccttttgcgtaaaaacaacggcagcaccgaaggcattgcc
aaagtcttttcccacgcgcaggcgttggcgcagtgcaacgactggttgggcagacacctg
cccaacgccgaacggattgccgtgtccagcaatgccgaagccgcaaggctggttgccgaa
tcggacgacggtacggttgccgccatcgccggacgcacggcggcggaaatctacggactc
gatatggttgccgagtgcatcgaagacgaaccgaacaacaccacgcgcttcttggtgatg
ggacatcacgaaaccggtgcaagcggcagcgacaagacttcgctggccgtttccgcgccc
aaccgggcaggcgcggttgcctcgctgctgcaaccgctgactgagtcgggtatttccatg
accaagtttgagagccgtccgagtaaatccgttttgtgggaatacctgttcttcatcgac
atcgaaggacaccgccgggacgcgcagattcagacggcattggaacgcttgggcgaacgc
gcttcgttcgtcaaagtcatcggttcgtacccgaccgccgttttgtag

DBGET integrated database retrieval system