KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA2060Help
Entry
NMA2060           CDS       T00031                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00473  D-Alanine metabolism
nma00550  Peptidoglycan biosynthesis
nma01100  Metabolic pathways
nma01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NMA2060
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMA2060
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NMA2060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nma01011]
    NMA2060
Enzymes [BR:nma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NMA2060
Peptidoglycan biosynthesis and degradation proteins [BR:nma01011]
 Precursor biosynthesis
  Amino acid ligase
   NMA2060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 RimK ATPgrasp_ST ATPgrasp_Ter ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: CAM09163
UniProt: Q9JSZ9
LinkDB All DBs
Position
complement(2007691..2008605)
Genome map
AA seq 304 aa AA seqDB search
MQNFGKVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKAQGFQTA
FNILHGTYGEDGAVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEFAVLH
DDTDFDAVEEKLGLPMFVKPAAEGSSVGVVKVKGKGRLKSVYEELKHFQGEIIAERFIGG
GEYSCPVLNGKGLPGIHIIPATEFYDYEAKYNRNDTIYQCPSEDLTEAEESLMRELAVRG
AQAIGAEGCVRVDFLKDTDGKLYLLEINTLPGMTGHSLVPKSAAVMGVGFADLCIEILKT
AHVG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattttggcaaagtggccgtattgatgggcggtttttccagcgaacgagaaatc
tcgctggacagcggcaccgccattttgaatgctttaaaaagcaaaggcatagacgcatac
gccttcgatcccaaggaaaccccattgtctgaattgaaggcacaaggttttcagacggca
ttcaacatccttcacggtacttacggcgaagacggggctgttcagggtgcattggaactg
ttgggcattccctataccggcagcggtgtcgccgcatccgccatcggcatggacaaatac
cgctgcaaactgatttggcaggcattgggattgcccgttcccgagttcgccgtcctgcac
gacgacactgatttcgatgccgtcgaagaaaaattgggcctgccgatgtttgtgaaaccg
gcggccgaaggcagcagcgtaggcgtggtaaaagtcaaaggaaaaggccgtctgaaaagc
gtttacgaagaattgaaacactttcagggcgaaatcattgccgaacggtttatcggcggc
ggcgaatattcctgccctgtgttgaacggcaaaggcctgcccggcatacacatcatcccc
gcgaccgagttttatgactacgaagccaagtacaaccgcaacgacaccatttatcaatgt
ccttcggaagatctgaccgaagccgaagaaagcctgatgcgcgaactggcggttcgcggc
gcgcaggcaatcggtgcggaaggctgcgtgcgcgtcgatttcctcaaagataccgacggc
aaactctatctgttggaaatcaacaccctgcccggtatgaccggccatagtttagtaccg
aaatccgctgccgttatgggcgtgggttttgccgatttatgtattgaaattttgaagacc
gcacatgtgggataa

DBGET integrated database retrieval system