KEGG   Neisseria meningitidis Z2491 (serogroup A): NMA2152Help
Entry
NMA2152           CDS       T00031                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
nma  Neisseria meningitidis Z2491 (serogroup A)
Pathway
nma00061  Fatty acid biosynthesis
nma00780  Biotin metabolism
nma01100  Metabolic pathways
nma01130  Biosynthesis of antibiotics
nma01212  Fatty acid metabolism
Module
nma_M00083  Fatty acid biosynthesis, elongation
nma_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NMA2152
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMA2152
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NMA2152
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nma01004]
    NMA2152
Enzymes [BR:nma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NMA2152
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NMA2152
Lipid biosynthesis proteins [BR:nma01004]
 Fatty acid synthase
  Component type
   NMA2152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CAM09248
UniProt: A0A0U1RKF3
LinkDB All DBs
Structure
PDB: 

Position
complement(2098349..2099134)
Genome map
AA seq 261 aa AA seqDB search
MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRKMAAELGSELV
FRCDVASDDEINQVFADLGKHWDGLDGLVHSIGFAPKEALSGDFLDSISREAFNTAHEIS
AYSLPALAKAARPMMRGRNSAIVALSYLGAVRAIPNYNVMGMAKASLEAGIRFTAACLGK
EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSSG
ITGEITYVDGGYSINALSTEG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctgcaaggcaaaaaaattctgattaccggcatgatttccgagcgttccatc
gcttatggcatcgccaaagcctgccgcgaacaaggcgcggaactggcgtttacctacgtt
gtggacaaactggaagagcgcgtccgcaaaatggcggcggaattgggttccgaactcgta
ttccgctgcgatgtcgccagcgacgacgaaatcaaccaagtgttcgccgacttgggcaaa
cattgggacggcttggacggtttggtgcattccatcggcttcgcgccgaaagaagccttg
agcggcgacttcctcgacagcatcagccgcgaagcgttcaacaccgcacacgaaatttcc
gcatacagcctgcccgcattggcaaaagccgcccgtccgatgatgcgcggcagaaactcc
gccatcgttgccctgagctacttgggcgcggtgcgcgcgattccaaattacaacgtgatg
ggtatggcaaaagccagccttgaggcgggcatccgttttaccgccgcctgtctgggcaaa
gaaggcatccgctgcaacggcatttccgccggcccgattaaaacgcttgccgcctccggt
atcgccgatttcggcaaacttttgggacacgtcgccgcccacaatccgctgcgccgcaac
gttaccattgaagaagtcggcaataccgccgccttcctgctgtccgacctgtcgtccggc
attaccggcgaaatcacttacgttgacggcggttacagcattaatgccttgagcaccgag
ggataa

DBGET integrated database retrieval system