KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0170Help
Entry
NMC0170           CDS       T00458                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc00061  Fatty acid biosynthesis
nmc00780  Biotin metabolism
nmc01100  Metabolic pathways
nmc01212  Fatty acid metabolism
Module
nmc_M00083  Fatty acid biosynthesis, elongation
nmc_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:nmc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NMC0170 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMC0170 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nmc01004]
    NMC0170 (fabZ)
Enzymes [BR:nmc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     NMC0170 (fabZ)
Lipid biosynthesis proteins [BR:nmc01004]
 Fatty acid synthase
  Component type
   NMC0170 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: CAM09489
UniProt: A1KRL1
LinkDB All DBs
Structure
PDB: 

Position
complement(164827..165276)
Genome map
AA seq 149 aa AA seqDB search
MDVQLPIEAKDIQKLIPHRYPFLQLDRITAFEPMKTLTAIKNVSINEPQFQGHFPDLPVM
PGVLIIEAMAQACGTLAILSEGGRKENEFFFFAGIDEARFKRQVIPGDQLVFEVELLTSR
RGIGKFNAVAKVDGQVAVEAIIMCAKRVV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacaactccccatcgaagccaaagacatccaaaaactcatcccccaccgctat
ccgtttctccagctcgaccgcatcaccgccttcgagccgatgaaaaccctgaccgcgatt
aaaaacgtcagcataaacgagccccagttccaaggccactttcccgacctgcccgtgatg
cccggcgtactcatcatcgaagcgatggcgcaagcctgcggcacgttggcgattttgagc
gaaggcgggcgcaaagaaaacgaattcttcttcttcgccggcatagacgaagcccgtttc
aaacgccaagtcatccccggcgaccaactcgtctttgaagtcgagctgctgaccagccgg
cgcggcatcggcaaattcaacgccgttgccaaagtggacgggcaagtcgccgtcgaagcc
atcatcatgtgtgccaaacgcgtggtttga

DBGET integrated database retrieval system