KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0539Help
Entry
NMC0539           CDS       T00458                                 

Definition
(GenBank) possible integral membrane protein
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzy_C_2 Wzy_C PglL_A TPR_2
Motif
Other DBs
NCBI-ProteinID: CAM09835
UniProt: A1KSK5
LinkDB All DBs
Position
complement(570801..572615)
Genome map
AA seq 604 aa AA seqDB search
MPAETTVSGAHPAAKLPIYILPCFLWIGIVPFTFALRLQPSPDFYHDAAAAAGLIVLLFL
TAGKKLFDVKIPPISFLLFAMAAFWYLQARLMNLIYPGMNDIVSWIFILLAVSAWACKSL
VAHYGQERIVTLLAWSLLIGSLLQSCIVVIQFAGWEDTPMLQNIIVYSGQGVIGHIGQRN
NLGHYLMWGILAAAYLNGQRKIPPALGAICLIMQTAVLGLVNSRTILTYIAAIALILPFW
YFRSDKSNRRTMLGIAAAVFLTALFQFSMNTILETFTGIRYETAVERVANGGFTDLPRQI
EWNKALAAFQSAPIFGHGWNSFAQQTFLINAEQHNIYDNLLSNLFTHSHNIVLQLLAEMG
ISGTLLVAATLLTGIAGLLKRPLTPASLFLICTLAVSMCHSMLEYPLWYVYFLIPFGLML
FLSPAEASDGIAFKKAANLGILTASAAIFAGLLHLDWTYTRLVNAFSPAPDDSAKTLNRK
INELRYISANSPMLSFYADFSLVNFALPEYPETQTWAEEATLKSLKYRPHSATYRIALYL
MRQGKVAEAKQWMRATQSYYPYLMPRYADEIRKLPVWAPLLPELLKDCKAFAAAPGHPEA
KPCK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgaaacgaccgtatccggcgcgcaccccgccgccaaactgccgatttacatc
ctgccctgcttcctttggataggcatcgtcccctttacctttgcgctcaggctgcaaccg
tcgcccgacttttaccacgatgccgccgccgcagccggcctgattgtcctgttgttcctc
acggcaggaaaaaagctgtttgatgtcaaaatcccacctatcagcttccttctgtttgca
atggcggcgttttggtatcttcaggcacgcctgatgaacctgatttaccccggtatgaac
gacatcgtctcttggattttcatcttgctcgccgtcagcgcgtgggcctgcaagagtttg
gtcgcacactacggacaagaacgcatcgttaccctgcttgcctggtcgctgcttatcggc
tccctgcttcaatcctgcatcgtcgtcatccagtttgccggctgggaagacacccccatg
cttcaaaacattattgtttacagcgggcaaggcgtaatcggacacatcggacagcgcaac
aacctcggacactacctgatgtggggcatactcgccgccgcctacctcaacggacaacga
aaaatcccgcccgccctcggcgcaatctgcctgattatgcagaccgccgttttaggtttg
gtcaattcgcgcaccatcttgacctacatagccgccatcgccctcatccttcccttctgg
tatttccgttcggacaaatccaacaggcggacgatgctcggcatagccgcagccgtattc
cttaccgcgctgttccaattttccatgaacaccattctggaaacctttaccggcatccgc
tacgaaactgccgtcgaacgcgttgccaacggcggtttcacagacttgccgcgccaaatc
gaatggaataaagcccttgccgccttccagtccgccccgatattcgggcacggctggaac
agttttgcccaacaaaccttcctcatcaatgccgaacagcacaacatatacgacaacctc
ctcagcaacttgttcacccattcccacaacatcgtcctccaactccttgcagagatggga
atcagcggcacgcttctggttgccgcaaccctgctgacgggcattgccgggctgctgaaa
cgccccctgacccccgcatcgcttttcctaatctgcacgcttgccgtcagtatgtgccac
agtatgctcgaatatcctttgtggtatgtctatttcctcatccctttcggactgatgctc
ttcctgtcccccgcagaggcttcagacggcatcgccttcaaaaaagccgccaatctcggc
atactgaccgcctccgccgccatattcgcaggattgctgcacttggactggacatacacc
cggctggttaacgccttttcccccgcccctgacgacagtgccaaaaccctcaaccggaaa
atcaacgagttgcgctatatttccgcaaacagtccgatgctgtccttttatgccgacttc
tccctcgtaaacttcgccctgccggaataccccgaaacccagacttgggcggaagaagca
accctcaaatcactaaaataccgcccccactccgccacctaccgcatcgccctctacctg
atgcggcaaggcaaagttgcagaagcaaaacaatggatgcgggcgacacagtcctattac
ccctacctgatgccccgatacgccgacgaaatccgcaaactgcccgtatgggcaccgctg
ctacccgaactgctcaaagactgcaaagccttcgccgccgcgcccggtcatccggaagca
aaaccctgcaaatga

DBGET integrated database retrieval system