KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0550Help
Entry
NMC0550           CDS       T00458                                 

Gene name
secD
Definition
(GenBank) putative protein-export membrane protein
  KO
K03072  preprotein translocase subunit SecD
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc03060  Protein export
nmc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:nmc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    NMC0550 (secD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NMC0550 (secD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nmc02044]
    NMC0550 (secD)
Secretion system [BR:nmc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   NMC0550 (secD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD-TM1 SecD_SecF MMPL Sec_GG ACR_tran
Motif
Other DBs
NCBI-ProteinID: CAM09845
UniProt: A1KSL5
LinkDB All DBs
Position
579350..581206
Genome map
AA seq 618 aa AA seqDB search
MMNRYPLWKYLLIVFTIAVAAVYSLPNLFGETPAVQVSTNRQAIIINEQTQSKVDAALQN
AGIQTDGMFVVDNSLKVRFKDTETQLKARDVIENTLGEGYITALNLLADSPEWMAKIKAN
PMFLGLDLRGGVHFTMQVDMKAAMQKTFERYSGGIRRELRREKIRSGTVRQAGNSLTVPL
QDAGDVQKALPQLRKLFPEATLNSDGSNIVLTLSEEAVNKVRSDAVKQNITTLHNRVNEL
GVAEPVIQQSGADRIVVQLPGVQDTAKAKDIIGRTATLELRMVEDDPAKLREALEGNVPS
GYELLSSGGDRPETLLISKQVELTGDNINDAQPSFDQMGAPAVSLSLDSAGGSIFGELTA
ANVGKRMAMVLIDQGKSEVVTAPVIRTAITGGRVEISGSMTTAEANDTSLLLRAGSLAAP
MQIVEERTIGPSLGKENIEKGFHSTLWGFAIVAAFMVVYYRLMGFFSTIALSANILFLIG
ILSAMQATLTLPGMAALALTLGMAIDSNVLINERIREELRVGVPPQQAINLGFQHAWATI
VDSNLTSLIAGIALLVFGSGPVRGFAVVHCLGILTSMYSSVVVFRALVNLWYGRRRKLQN
ISIGAVWKPEAETAAGKE
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccgttatcctttatggaaatatctgctgattgtgttcacgattgcggttgcc
gcagtgtattcgctgcccaacctattcggcgaaacacccgccgtgcaggtatcgaccaac
cgacaagccatcatcatcaacgaacagactcaatccaaagtggatgccgcgctgcaaaac
gcgggtattcagaccgacgggatgtttgttgtggacaattcactgaaagtgcgtttcaaa
gacacagaaacgcagcttaaagcgcgcgacgtcatcgaaaacactttgggcgaagggtat
attaccgcgctcaacctgttggcggacagccccgaatggatggcgaaaatcaaagccaat
ccgatgtttttgggtttggacctgcgcggcggcgtgcatttcaccatgcaggtcgatatg
aaagcggcgatgcagaaaacgtttgaacgttattcgggcggcatccgccgcgaactgcgc
cgcgaaaaaatccgcagcggcacggtgcgtcaggctggaaacagcctgaccgtccctttg
caggatgcaggtgatgtgcaaaaggcactgccgcagttgcgcaagctgtttcctgaagca
acgctgaattcagacggcagcaatatcgtcttgacgctttcggaagaggcggtcaataaa
gtgcgttccgatgcggtcaaacagaacatcactaccctgcacaaccgtgtgaacgagttg
ggcgtggccgaacccgtcatccagcagtcaggtgcagaccgtatcgtcgtgcagcttccg
ggcgttcaggatactgccaaggcaaaagacatcatcggccgtaccgcgactttggaattg
cgtatggtggaggacgatcctgccaagttgcgcgaggcattggaaggcaacgtgccgagc
ggttatgagctgctttcaagcggcggagatcgtcccgaaactctgctaatcagcaaacag
gtcgagctgacgggcgacaacatcaacgatgcgcaaccgagtttcgaccaaatgggcgca
cctgccgtcagtctgagcttggacagcgcgggcggcagcattttcggcgaactgactgcc
gcaaatgtcggcaaacgcatggcgatggttttgatcgaccaaggaaaatccgaggttgta
accgcgccggttatccgtactgccattaccggcggacgcgtggaaatttccggaagcatg
acgacagccgaagccaatgatacgtctttgctgttgcgtgccggttctcttgccgcgccg
atgcagattgtcgaagaacgtaccatcggtccgtctttgggtaaggagaacatcgaaaaa
ggcttccattcgactttatggggttttgccatcgttgctgcattcatggtggtttactat
cgtctgatgggtttcttttctaccattgcattgagtgccaacatactgttcctaatcggt
attttgtctgctatgcaggcaacgttgacgttaccgggtatggccgcgctggcgttgact
ttgggtatggcaatcgactccaacgtcttgattaacgaacgtatccgcgaagaattgcgt
gtcggcgtgccgccgcagcaggcaatcaatctcggtttccaacacgcatgggcgaccatt
gtcgattccaacctgacttcgctgattgccggtatcgcgcttttggtattcggttccggc
ccggtacgcggttttgcggtcgtacactgtttgggtattctgacttcgatgtattcgtcc
gtcgtcgtattccgtgcgttggtcaatctgtggtacggacgcagacgcaaattgcagaat
atttccatcggtgcggtatggaaacctgaagccgaaactgcggcaggtaaggagtaa

DBGET integrated database retrieval system