KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0552Help
Entry
NMC0552           CDS       T00458                                 

Gene name
rpsO
Definition
(GenBank) putative 30S ribosomal protein S15
  KO
K02956  small subunit ribosomal protein S15
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc03010  Ribosome
Module
nmc_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:nmc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NMC0552 (rpsO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nmc03011]
    NMC0552 (rpsO)
Ribosome [BR:nmc03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    NMC0552 (rpsO)
  Bacteria
    NMC0552 (rpsO)
  Archaea
    NMC0552 (rpsO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S15
Motif
Other DBs
NCBI-ProteinID: CAM09847
UniProt: A1KSL7
LinkDB All DBs
Position
582368..582637
Genome map
AA seq 89 aa AA seqDB search
MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFKANPKDHHSRRGLLKMV
SQRRRLLAYLRRTQPDTYRALITRLGLRK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaccgtagaacaaaaagcacaaatcgttaaagatttccaacgcaaagaaggc
gacaccggctcttccgaagtacaagtcgctctgttgactttccgcatcaacgacctgacc
ccccacttcaaagccaaccccaaagaccaccacagccgtcgcggcctgttgaaaatggtc
agccaacgccgccgcctgctggcctacttgcgccgtacccagcccgatacgtatcgcgcg
ttgattacccgcttgggtctgcgtaaataa

DBGET integrated database retrieval system