KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0554Help
Entry
NMC0554           CDS       T00458                                 

Definition
(GenBank) putative polyamine permease inner membrane protein
  KO
K11075  putrescine transport system permease protein
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:nmc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NMC0554
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nmc02000]
    NMC0554
Transporters [BR:nmc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter
    NMC0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF4634
Motif
Other DBs
NCBI-ProteinID: CAM09849
UniProt: A1KSL9
LinkDB All DBs
Position
584159..585124
Genome map
AA seq 321 aa AA seqDB search
MNLNKLKNKLFRRPGQRVVIAVPYIWLLVLFLIPFAIVLKISFAEQEIAIPPFTPLTSID
EDLGRLNITISYQNYADIFQNFWHTLNPFGDSENSNIYLMTYWSSIKTALMTTVICLLVG
YPTAYAISRANPSVRNGLLLAIMLPFWTSFLLRVYAWMGLLGHNGIVNNLLIKMGIISEP
LDLFYNAFSLNLVMVYAYLPFMILPLYTQLVKLDNRLLEAASDLGAGPVKSFLTITLPLS
KTGIIAGSMLVFVPAVGEFVIPELVGGSENLMIGKVLWQAFFDQNNWPLASAVAVVMVAL
LVVPIALFQHYENRELEEGAK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttaataaactgaaaaacaaactgttccgccgcccggggcagcgtgtggtgatt
gccgtaccgtatatttggcttttggtgctgtttctgattccgttcgccatcgtgctgaaa
atcagctttgccgaacaagaaatcgccattccgccgtttacgccgctgaccagcatcgac
gaagatttaggtcgtctgaatatcaccatcagttatcaaaactatgccgatattttccaa
aatttttggcatacccttaacccgttcggcgacagtgaaaacagcaatatctatctgatg
acctactggtcttcaatcaaaaccgcattgatgacgacagtgatttgcctgttggtcggt
tatccgaccgcctatgcgatttctcgtgccaatccttctgtccgcaatggtttgctgctt
gccattatgctgcccttttggacatcgttcctgttgcgcgtctatgcgtggatgggtctg
ctcgggcataacggtattgtaaacaacctgttgattaaaatgggtattatcagcgagcct
ttggatttgttctacaatgccttttcgctcaatttggtgatggtttacgcctatctgccg
tttatgattctgccgctatacacgcaactggtgaaactcgacaaccgcctgcttgaagcg
gcttccgatttgggcgcggggccggtcaaatcgttcttgacgattaccctgcctttgtcg
aaaaccggcattattgcaggctccatgctggttttcgtccctgctgtcggcgagttcgtc
attcccgagctggtcggcggttcggaaaacctgatgattggtaaagtcttgtggcaggcg
ttcttcgatcaaaacaactggccgctggcttccgccgtcgccgtcgtgatggtcgcgctg
ctggtcgtgccgattgccctgtttcagcattatgaaaaccgcgaattggaagaaggagcc
aaataa

DBGET integrated database retrieval system